Anas acuta (northern pintail): 137841578 Help Entry 137841578         CDS       T11380                                  Symbol CENPX Name (RefSeq) centromere protein X isoform X1   KO K15360   centromere protein X Organism aacu  Anas acuta (northern pintail) Pathway aacu03460   Fanconi anemia pathway Brite KEGG Orthology (KO) [BR:aacu00001]  09120 Genetic Information Processing   09124 Replication and repair    03460 Fanconi anemia pathway     137841578 (CENPX)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03400 DNA repair and recombination proteins [BR:aacu03400]     137841578 (CENPX) DNA repair and recombination proteins [BR:aacu03400]  Eukaryotic type   DSBR (double strand breaks repair)    FA (Fanconi anemia) pathway     FA core complex binding factors      137841578 (CENPX) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Other DBs NCBI-GeneID:  137841578 NCBI-ProteinID:  XP_068510699 LinkDB All DBs Position 18:complement(13255796..13257396) Genome browser AA seq 125 aa AA seqDB search MAAARRHLPPPGAALPPRSRAPPPPRPGRTSAGRGRPRAPPWRSGTAASGRTPWSGCSAC TSVTTGRERLVVAVNGDALRLTAELLKVFVREAAARAARQAQAEDVENVNIEHVEKVLPQ LLLDF NT seq 378 nt NT seq  +upstreamnt  +downstreamnt atggccgcggcgcggcgccacctcccgccgccgggcgcggcgctgccgccacggagccgc gcccccccccccccccgccccggccgcacttccgcggggcggggccggccgcgcgcgccg ccatggaggagcgggacggcggcttcaggaaggacaccgtggagcggctgctccgcctgc acttccgtgacgacaggacgcgagcgccttgtcgttgcagttaacggcgacgctctgcgg ctgacggcggagctgctcaaggtcttcgtgcgagaagcagcggcacgagcagcgcggcag gctcaagcggaggacgtggaaaacgtgaatattgagcatgtagagaaagtgctgccacag ctgctcctagatttctag

DBGET integrated database retrieval system