Anas acuta (northern pintail): 137845321 Help Entry 137845321         CDS       T11380                                  Symbol H2AZ2 Name (RefSeq) histone H2A.V   KO K11251   histone H2A Organism aacu  Anas acuta (northern pintail) Pathway aacu03082   ATP-dependent chromatin remodeling aacu04217   Necroptosis Brite KEGG Orthology (KO) [BR:aacu00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     137845321 (H2AZ2)  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     137845321 (H2AZ2)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:aacu03036]     137845321 (H2AZ2)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:aacu04147]     137845321 (H2AZ2) Chromosome and associated proteins [BR:aacu03036]  Eukaryotic type   Nucleosome assembly factors    Histones     137845321 (H2AZ2) Exosome [BR:aacu04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    137845321 (H2AZ2) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Other DBs NCBI-GeneID:  137845321 NCBI-ProteinID:  XP_068518526 LinkDB All DBs Position 27:4160667..4165175 Genome browser AA seq 128 aa AA seqDB search MAGGKAGKDSGKAKAKAVSRSQRAGLQFPVGRIHRHLKTRTTSHGRVGATAAVYSAAILE YLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIG KKGQQKTA NT seq 387 nt NT seq  +upstreamnt  +downstreamnt atggctggaggtaaagctggcaaggacagcggcaaggccaaggccaaggcggtgtcccgc tcccagagagccgggctgcagttcccggtgggccgcatccacaggcacttgaagacccgc actacgagccacgggcgagtgggagccaccgcggccgtgtacagcgccgccatcctcgag tacctcaccgccgaggtgctggagctggcaggcaacgcttcgaaggacctgaaggtgaag cgcatcactccccgtcacttgcagctcgccatccgcggcgacgaagagctggactccctc atcaaagccaccatcgctgggggaggcgtcatcccccacatccacaagtctctgatcggg aagaagggacagcagaaaaccgcgtaa

DBGET integrated database retrieval system