Anas acuta (northern pintail): 137849389 Help Entry 137849389         CDS       T11380                                  Name (RefSeq) histone H2A type 2-C   KO K11251   histone H2A Organism aacu  Anas acuta (northern pintail) Pathway aacu03082   ATP-dependent chromatin remodeling aacu04217   Necroptosis Brite KEGG Orthology (KO) [BR:aacu00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     137849389  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     137849389  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:aacu03036]     137849389   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:aacu04147]     137849389 Chromosome and associated proteins [BR:aacu03036]  Eukaryotic type   Nucleosome assembly factors    Histones     137849389 Exosome [BR:aacu04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    137849389 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Other DBs NCBI-GeneID:  137849389 NCBI-ProteinID:  XP_068525056 LinkDB All DBs Position 1:161148745..161149237 Genome browser AA seq 129 aa AA seqDB search MSGRGKQGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLT AEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKK TESHKAKSK NT seq 390 nt NT seq  +upstreamnt  +downstreamnt atgtccgggcgcgggaagcagggcgggaaggcgcgggccaaggccaagtcgcgctcgtcg cgggccgggctgcagttccccgtgggccgcgtgcaccggctgctgcgcaagggcaactac gcggagcgggtgggcgccggcgccccggtgtacctggcggccgtgctggagtacctgacg gccgagatcctggagctggcgggcaacgcggcccgcgacaacaagaagacgcgcatcatc ccccgccacctgcagctggccatccgcaacgacgaggagctcaacaagctgctgggcaag gtcaccatcgcgcagggcggggtgctgcccaacatccaggccgtgctgctgcccaagaag accgaaagccacaaggccaagagcaagtaa

DBGET integrated database retrieval system