Anas acuta (northern pintail): 137849951 Help Entry 137849951         CDS       T11380                                  Name (RefSeq) calmodulin, striated muscle   KO K02183   calmodulin Organism aacu  Anas acuta (northern pintail) Pathway aacu04020   Calcium signaling pathway aacu04070   Phosphatidylinositol signaling system aacu04114   Oocyte meiosis aacu04218   Cellular senescence aacu04261   Adrenergic signaling in cardiomyocytes aacu04270   Vascular smooth muscle contraction aacu04371   Apelin signaling pathway aacu04625   C-type lectin receptor signaling pathway aacu04744   Phototransduction aacu04910   Insulin signaling pathway aacu04912   GnRH signaling pathway aacu04916   Melanogenesis Brite KEGG Orthology (KO) [BR:aacu00001]  09130 Environmental Information Processing   09132 Signal transduction    04371 Apelin signaling pathway     137849951    04020 Calcium signaling pathway     137849951    04070 Phosphatidylinositol signaling system     137849951  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     137849951    04218 Cellular senescence     137849951  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     137849951   09152 Endocrine system    04910 Insulin signaling pathway     137849951    04912 GnRH signaling pathway     137849951    04916 Melanogenesis     137849951   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     137849951    04270 Vascular smooth muscle contraction     137849951   09157 Sensory system    04744 Phototransduction     137849951  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:aacu01009]     137849951   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:aacu04131]     137849951    03036 Chromosome and associated proteins [BR:aacu03036]     137849951   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:aacu04147]     137849951 Protein phosphatases and associated proteins [BR:aacu01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      137849951 Membrane trafficking [BR:aacu04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     137849951 Chromosome and associated proteins [BR:aacu03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      137849951 Exosome [BR:aacu04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    137849951 SSDB OrthologParalogGFIT Motif Pfam:  EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_8 EF-hand_5 EF-hand_9 AIF-1 CFAP251_C EF-hand_FSTL1 Allatotropin-like_C EF_EFCAB10_C EH SPARC_Ca_bdg EF_SSP120 EF-hand_11 EF-hand_EFHB_C EFhand_Ca_insen Dockerin_1 UPF0154 SAPC2_N Caleosin DUF5580_M BamM_C FCaBP_EF-hand SPEF2_C SurA_N_3 DUF8640 Motif Other DBs NCBI-GeneID:  137849951 NCBI-ProteinID:  XP_068526240 LinkDB All DBs Position 1 Genome browser AA seq 149 aa AA seqDB search MAERLSEEQIAEFKEAFSLFDRDGDGCITTKELGTVMRSLGQNPTEAELQDMVGEVDADG SGTIDFPEFLSLMARKMRDSDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDE EVDEMIKEADCNNDGQVNYEEFVRMMTEK NT seq 450 nt NT seq  +upstreamnt  +downstreamnt atggccgagcggctgtcggaggagcagatcgccgagttcaaggaggctttttcccttttc gaccgcgacggcgacggctgcatcaccaccaaggagctgggcaccgtcatgcgctcgttg gggcagaaccccaccgaggcggagctgcaggacatggtgggcgaggtggacgccgacggc agcggcaccatcgacttccccgagttcctctcgctgatggcgaggaagatgagggactcg gacagcgaggaggagatccgcgaggccttccgcgtcttcgacaaggacggcaacggctac atcagcgcggcggagctgcggcacgtcatgaccaacctgggcgagaagctgacggacgag gaggtggacgagatgatcaaggaggccgactgcaacaacgacgggcaggtcaactacgag gagttcgtgaggatgatgacggagaagtga

DBGET integrated database retrieval system