Anas acuta (northern pintail): 137864036
Help
Entry
137864036 CDS
T11380
Symbol
SKP1
Name
(RefSeq) S-phase kinase-associated protein 1
KO
K03094
S-phase kinase-associated protein 1
Organism
aacu Anas acuta (northern pintail)
Pathway
aacu03083
Polycomb repressive complex
aacu04110
Cell cycle
aacu04114
Oocyte meiosis
aacu04120
Ubiquitin mediated proteolysis
aacu04141
Protein processing in endoplasmic reticulum
aacu04310
Wnt signaling pathway
aacu04350
TGF-beta signaling pathway
aacu05132
Salmonella infection
Brite
KEGG Orthology (KO) [BR:
aacu00001
]
09120 Genetic Information Processing
09123 Folding, sorting and degradation
04141 Protein processing in endoplasmic reticulum
137864036 (SKP1)
04120 Ubiquitin mediated proteolysis
137864036 (SKP1)
09126 Chromosome
03083 Polycomb repressive complex
137864036 (SKP1)
09130 Environmental Information Processing
09132 Signal transduction
04310 Wnt signaling pathway
137864036 (SKP1)
04350 TGF-beta signaling pathway
137864036 (SKP1)
09140 Cellular Processes
09143 Cell growth and death
04110 Cell cycle
137864036 (SKP1)
04114 Oocyte meiosis
137864036 (SKP1)
09160 Human Diseases
09171 Infectious disease: bacterial
05132 Salmonella infection
137864036 (SKP1)
09180 Brite Hierarchies
09182 Protein families: genetic information processing
04131 Membrane trafficking [BR:
aacu04131
]
137864036 (SKP1)
04121 Ubiquitin system [BR:
aacu04121
]
137864036 (SKP1)
03036 Chromosome and associated proteins [BR:
aacu03036
]
137864036 (SKP1)
Membrane trafficking [BR:
aacu04131
]
Endosome - Lysosome transport
Acidification regulators
RAVE complex
137864036 (SKP1)
Ubiquitin system [BR:
aacu04121
]
Ubiquitin ligases (E3)
Multi subunit type E3
SCF complex
Adaptor protein
137864036 (SKP1)
Cul7 complex
137864036 (SKP1)
Chromosome and associated proteins [BR:
aacu03036
]
Eukaryotic type
Histone modification proteins
Polycomb repressive complex (PRC) and associated proteins
Noncanonical PRC1 (PRC1.1)
137864036 (SKP1)
Centromeric chromatin formation proteins
Kinetochore proteins
CBF3 complex
137864036 (SKP1)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Other DBs
NCBI-GeneID:
137864036
NCBI-ProteinID:
XP_068553867
LinkDB
All DBs
Position
14:complement(2959647..2968389)
Genome browser
AA seq
163 aa
AA seq
DB search
MPSIKLQSSDGEIFEVDVEIAKQSVTIKTMLEDLGMDDEGDDDPVPLPNVNAAILKKVIQ
WCTHHKDDPPPPEDDENKEKRTDDIPVWDQEFLKVDQGTLFELILAANYLDIKGLLDVTC
KTVANMIKGKTPEEIRKTFNIKNDFTEEEEAQVRKENQWCEEK
NT seq
492 nt
NT seq
+upstream
nt +downstream
nt
atgccttcaattaaactgcagagttcagatggagagatttttgaagttgatgttgaaatt
gcaaagcagtctgtaaccataaagactatgctggaagatctgggaatggatgatgaaggt
gatgatgacccagtccctcttccaaatgttaatgcagctattttaaaaaaggtgattcag
tggtgcacccatcacaaagatgatccacctcctcctgaggatgatgagaacaaagagaaa
agaacagatgacatccctgtgtgggatcaagaattcctgaaagtagaccaaggaacactt
tttgaacttatcctggctgcaaattacttggacatcaaaggcttgcttgatgtcacatgc
aagacagttgcaaacatgatcaaggggaaaactccagaagaaattcgcaagacattcaat
attaagaatgacttcactgaagaggaagaagcacaggtacgtaaagagaaccagtggtgt
gaagagaagtga
DBGET
integrated database retrieval system