Alicyclobacillus acidocaldarius subsp. acidocaldarius Tc-4-1: TC41_1265
Help
Entry
TC41_1265 CDS
T01821
Symbol
coaD
Name
(GenBank) pantetheine-phosphate adenylyltransferase
KO
K00954
pantetheine-phosphate adenylyltransferase [EC:
2.7.7.3
]
Organism
aad
Alicyclobacillus acidocaldarius subsp. acidocaldarius Tc-4-1
Pathway
aad00770
Pantothenate and CoA biosynthesis
aad01100
Metabolic pathways
aad01240
Biosynthesis of cofactors
Module
aad_M00120
Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:
aad00001
]
09100 Metabolism
09108 Metabolism of cofactors and vitamins
00770 Pantothenate and CoA biosynthesis
TC41_1265 (coaD)
Enzymes [BR:
aad01000
]
2. Transferases
2.7 Transferring phosphorus-containing groups
2.7.7 Nucleotidyltransferases
2.7.7.3 pantetheine-phosphate adenylyltransferase
TC41_1265 (coaD)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
CTP_transf_like
Citrate_ly_lig
Motif
Other DBs
NCBI-ProteinID:
AEJ43205
UniProt:
F8IHC0
LinkDB
All DBs
Position
1255597..1256094
Genome browser
AA seq
165 aa
AA seq
DB search
MRKAVYPGTFDPITLGHVDVIEQVAPLFDELVVAVLHNPSKRPWFDLDERLDMIREAVRP
YPHVRVDAFTGLLVDYCRSSGIACVVRGVRNHVDLQNEMAMAQMNRALYADLVTLFIPTS
PEWSFVSSSLVKDVAMHGGDVSRFVTPRVAAALTARAEGREQRHV
NT seq
498 nt
NT seq
+upstream
nt +downstream
nt
atgcgcaaagccgtgtatcctggaacgtttgatcccatcacgctcgggcacgtggacgtg
atcgagcaagtcgcgccgctgttcgacgaactcgtggtcgcggtcttacacaatccttcg
aagcgcccctggttcgatctcgacgagcggctcgacatgattcgggaggccgttcgcccc
tatccccacgtgcgcgtcgacgcgttcaccgggcttctcgtggactactgccgctcgtct
ggaattgcgtgcgtcgtgcgcggcgtacgcaatcacgtcgacctgcagaacgagatggcc
atggcgcaaatgaaccgggcgctgtacgccgatctcgtcacgctcttcatcccgacttcg
cccgaatggtcgttcgtcagttcgtcgctcgtcaaggacgtggccatgcacgggggcgat
gtgtcgcgatttgtgacgccgcgagtagccgcggcacttaccgcgcgcgcggaagggcga
gagcaacgccatgtctga
DBGET
integrated database retrieval system