Aquifex aeolicus: aq_1484a Help Entry aq_1484a          CDS       T00013                                  Symbol himA Name (GenBank) DNA binding protein HU   KO K04764   integration host factor subunit alpha Organism aae  Aquifex aeolicus Brite KEGG Orthology (KO) [BR:aae00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:aae03032]     aq_1484a (himA)    03036 Chromosome and associated proteins [BR:aae03036]     aq_1484a (himA)    03400 DNA repair and recombination proteins [BR:aae03400]     aq_1484a (himA) DNA replication proteins [BR:aae03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     aq_1484a (himA) Chromosome and associated proteins [BR:aae03036]  Prokaryotic type   Nucleoid associated proteins    IHF (integration host factor)     aq_1484a (himA) DNA repair and recombination proteins [BR:aae03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHDIR (short-homology-dependent illegitimate recombination)      Facilitator       aq_1484a (himA) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-CCDC81_euk_1 HU-HIG HU-CCDC81_euk_2 HU-CCDC81_bac_1 DUF531 HU-CCDC81_bac_2 Motif Other DBs NCBI-ProteinID:  AAC07415 UniProt:  O67461 LinkDB All DBs Position complement(1057616..1057900) Genome browser AA seq 94 aa AA seqDB search MTKKEIAEEIYDRLIRDYNVKIQKKEVYNLVSEVFTIIQECLLKGEKVKISGFGTFVVKT RKPKKGMNIKKREIVEVPERKIVLFKPSKNFIKS NT seq 285 nt NT seq  +upstreamnt  +downstreamnt atgactaaaaaagaaatagcggaagagatttacgaccgccttataagggattacaacgta aaaatacagaaaaaggaagtatataacctcgtctcggaagttttcactataattcaggag tgtctcctaaaaggtgaaaaggtaaagatatccggcttcggtacctttgtagtaaaaaca agaaagccaaagaaaggtatgaacataaaaaagagggaaatcgtggaggttcccgagagg aaaatagtcctatttaaacccagtaagaacttcataaagtcatga

DBGET integrated database retrieval system