Achromobacter aegrifaciens: RA224_25085 Help Entry RA224_25085       CDS       T09343                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism aaeg  Achromobacter aegrifaciens Pathway aaeg00998   Biosynthesis of various antibiotics aaeg01100   Metabolic pathways aaeg01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:aaeg00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     RA224_25085 (acpP)    00074 Mycolic acid biosynthesis     RA224_25085 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     RA224_25085 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7080 PP-binding_2 DUF1896 HLH Ribosomal_L50 EutQ DUF1493 Motif Other DBs NCBI-ProteinID:  WLW60475 LinkDB All DBs Position complement(5380162..5380401) Genome browser AA seq 79 aa AA seqDB search MESIEQRVKKIVAEQLGVNEAEIKNESSFLDDLGADSLDMVELVMALEDEFETEIPDEEA EKITTVQQAIDYINSHGKQ NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atggaaagcatcgaacagcgcgtcaagaagatcgtcgctgaacaacttggcgtcaacgaa gccgagatcaagaacgaatcctccttccttgacgacctcggtgccgattcgctcgacatg gtcgaactggtcatggcgctcgaagacgaattcgagaccgagatccccgacgaagaggcc gaaaagatcacgaccgtgcaacaagcgattgactacatcaattcgcacggcaagcagtaa

DBGET integrated database retrieval system