Aureococcus anophagefferens: AURANDRAFT_16575 Help Entry AURANDRAFT_16575  CDS       T04134                                  Name (RefSeq) hypothetical protein   KO K05754   actin related protein 2/3 complex, subunit 5 Organism aaf  Aureococcus anophagefferens Pathway aaf04144   Endocytosis aaf05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:aaf00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     AURANDRAFT_16575  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     AURANDRAFT_16575  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:aaf04131]     AURANDRAFT_16575   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:aaf04812]     AURANDRAFT_16575 Membrane trafficking [BR:aaf04131]  Others   Actin-binding proteins    Arp2/3 complex     AURANDRAFT_16575 Cytoskeleton proteins [BR:aaf04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Arp2/3 complex      AURANDRAFT_16575 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  P16-Arc Utp12 DUF1198 Motif Other DBs NCBI-GeneID:  20218686 NCBI-ProteinID:  XP_009033644 JGI:  Auran1_16575 UniProt:  F0Y0P6 LinkDB All DBs Position Unknown AA seq 77 aa AA seqDB search RARPQVFASIARIDDKQIDATVDKMEQEPADILLKYVYRGLEEPTDNNASLFKWQAKILD KFGIGSVVRVLTDRKTV NT seq 231 nt NT seq  +upstreamnt  +downstreamnt cgcgcgcgcccgcaggtcttcgcgtccatcgcgcgcatcgacgacaagcagatcgacgcg acggtcgacaagatggagcaggagcccgcggacatcctcctcaagtacgtctaccgcggc ctcgaggagccgacggacaacaacgcgtcgctcttcaaatggcaggcgaagatcctcgac aagttcggcatcggctccgtcgtccgcgtcctcacggacaggaagacggtg

DBGET integrated database retrieval system