Aureococcus anophagefferens: AURANDRAFT_16660 Help Entry AURANDRAFT_16660  CDS       T04134                                  Name (RefSeq) hypothetical protein   KO K02183   calmodulin Organism aaf  Aureococcus anophagefferens Pathway aaf04070   Phosphatidylinositol signaling system Brite KEGG Orthology (KO) [BR:aaf00001]  09130 Environmental Information Processing   09132 Signal transduction    04070 Phosphatidylinositol signaling system     AURANDRAFT_16660  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:aaf01009]     AURANDRAFT_16660   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:aaf04131]     AURANDRAFT_16660    03036 Chromosome and associated proteins [BR:aaf03036]     AURANDRAFT_16660   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:aaf04147]     AURANDRAFT_16660 Protein phosphatases and associated proteins [BR:aaf01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      AURANDRAFT_16660 Membrane trafficking [BR:aaf04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     AURANDRAFT_16660 Chromosome and associated proteins [BR:aaf03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      AURANDRAFT_16660 Exosome [BR:aaf04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    AURANDRAFT_16660 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_8 EF-hand_5 EH EF-hand_FSTL1 DUF5580_M Allatotropin-like_C EF-hand_EFHB_C SPARC_Ca_bdg DUF5580 Pex19 Motif Other DBs NCBI-GeneID:  20218699 NCBI-ProteinID:  XP_009039700 JGI:  Auran1_16660 UniProt:  F0YGY6 LinkDB All DBs Position Unknown AA seq 80 aa AA seqDB search KQTLRRLQETFAEIDEDGSGYLSPEELAALFKKLRMPMSQSKLEDIVDEVDIDGNGLIDF EEFLLVVKNMKNMKSVQSKL NT seq 240 nt NT seq  +upstreamnt  +downstreamnt aagcagacgctgcggcggctccaggagaccttcgcggagatcgacgaggacgggagcggc tacctgagccccgaggagctcgcggcgctcttcaagaagctgcgcatgcccatgtcccag tccaagctcgaggacatcgtcgacgaggtcgacatcgacggcaacgggctcatcgacttc gaggagttcctgctggtcgtgaagaacatgaagaacatgaagtccgtgcagtcgaagctc

DBGET integrated database retrieval system