Aureococcus anophagefferens: AURANDRAFT_17032 Help Entry AURANDRAFT_17032  CDS       T04134                                  Name (RefSeq) hypothetical protein   KO K02927   ubiquitin-large subunit ribosomal protein L40e Organism aaf  Aureococcus anophagefferens Pathway aaf03010   Ribosome aaf04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:aaf00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     AURANDRAFT_17032   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     AURANDRAFT_17032  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:aaf03011]     AURANDRAFT_17032    04121 Ubiquitin system [BR:aaf04121]     AURANDRAFT_17032 Ribosome [BR:aaf03011]  Ribosomal proteins   Eukaryotes    Large subunit     AURANDRAFT_17032   Archaea     AURANDRAFT_17032 Ubiquitin system [BR:aaf04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    AURANDRAFT_17032 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  ubiquitin Rad60-SLD Ubiquitin_5 Ubiquitin_2 Rad60-SLD_2 Dsc3_N Cas9_b_hairpin Motif Other DBs NCBI-GeneID:  20218767 NCBI-ProteinID:  XP_009036136 JGI:  Auran1_17032 UniProt:  F0Y7G2 LinkDB All DBs Position Unknown AA seq 75 aa AA seqDB search QIFIKTLTGRKQAMTLEPSDEVRTIKQSLQEKEGIQVDQIRLIYSGKQLADDKKIEFYNI QAGGTIHMVLQLRGG NT seq 225 nt NT seq  +upstreamnt  +downstreamnt cagatcttcatcaagacgctcacgggccgcaagcaggccatgaccctcgagccgagcgac gaggtgcggacgatcaagcagtcgctccaggagaaggagggcatccaggtggaccagatc cgcctcatctactccggcaagcagctcgccgacgacaagaagatcgagttctacaacatc caggccgggggcacgatccacatggtcctccagctccgcggcggc

DBGET integrated database retrieval system