Aureococcus anophagefferens: AURANDRAFT_17572 Help Entry AURANDRAFT_17572  CDS       T04134                                  Name (RefSeq) hypothetical protein   KO K03671   thioredoxin Organism aaf  Aureococcus anophagefferens Brite KEGG Orthology (KO) [BR:aaf00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:aaf03110]     AURANDRAFT_17572 Chaperones and folding catalysts [BR:aaf03110]  Protein folding catalysts   Protein disulfide isomerase    AURANDRAFT_17572 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Thioredoxin OST3_OST6 Thioredoxin_2 Motif Other DBs NCBI-GeneID:  20218853 NCBI-ProteinID:  XP_009034024 JGI:  Auran1_17572 UniProt:  F0Y0U5 LinkDB All DBs Position Unknown AA seq 55 aa AA seqDB search VAPQYKKMANQFWPKAVLMRADVDEAKDLAMACSVTSAPTFIFFKNAKPVDKCKG NT seq 165 nt NT seq  +upstreamnt  +downstreamnt gttgcgccgcaatacaagaagatggcgaaccagttctggcccaaggccgtgctcatgcgc gccgacgtcgacgaggccaaggatctagccatggcctgctccgtgacgtccgcgccgacc ttcatcttcttcaagaacgcgaagcccgtggacaagtgcaagggc

DBGET integrated database retrieval system