Aureococcus anophagefferens: AURANDRAFT_17670 Help Entry AURANDRAFT_17670  CDS       T04134                                  Name (RefSeq) hypothetical protein   KO K02927   ubiquitin-large subunit ribosomal protein L40e Organism aaf  Aureococcus anophagefferens Pathway aaf03010   Ribosome aaf04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:aaf00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     AURANDRAFT_17670   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     AURANDRAFT_17670  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:aaf03011]     AURANDRAFT_17670    04121 Ubiquitin system [BR:aaf04121]     AURANDRAFT_17670 Ribosome [BR:aaf03011]  Ribosomal proteins   Eukaryotes    Large subunit     AURANDRAFT_17670   Archaea     AURANDRAFT_17670 Ubiquitin system [BR:aaf04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    AURANDRAFT_17670 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  ubiquitin Rad60-SLD Ubiquitin_2 Ubiquitin_5 TBK1_ULD HemeBinding_Shp Dsc3_N UBL_UBAC1 TmoB Motif Other DBs NCBI-GeneID:  20218870 NCBI-ProteinID:  XP_009036671 JGI:  Auran1_17670 UniProt:  F0Y8P6 LinkDB All DBs Position Unknown AA seq 69 aa AA seqDB search LTEKIITLDIDYSDTIDNVKQKIQVAEGIPPDQQRMVYEGKQLEDGRTIADYCIKNESTI CLVLRLRGG NT seq 207 nt NT seq  +upstreamnt  +downstreamnt ctgacggagaagatcattacgctcgacatcgattactcggacacgatcgacaacgtcaag cagaagatccaagtcgctgagggcatcccgccggaccagcagcgcatggtctacgagggt aagcagctcgaagatggtcggacgatcgcggactactgcatcaagaacgagtcgacgatt tgcctcgtgctccgcctccgcggcggc

DBGET integrated database retrieval system