Aureococcus anophagefferens: AURANDRAFT_17782 Help Entry AURANDRAFT_17782  CDS       T04134                                  Name (RefSeq) hypothetical protein   KO K10418   dynein light chain LC8-type Organism aaf  Aureococcus anophagefferens Pathway aaf04814   Motor proteins Brite KEGG Orthology (KO) [BR:aaf00001]  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     AURANDRAFT_17782  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:aaf03037]     AURANDRAFT_17782    04812 Cytoskeleton proteins [BR:aaf04812]     AURANDRAFT_17782 Cilium and associated proteins [BR:aaf03037]  Motile cilia and associated proteins   Dynein arm    AURANDRAFT_17782 Cytoskeleton proteins [BR:aaf04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      AURANDRAFT_17782 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Dynein_light Motif Other DBs NCBI-GeneID:  20218895 NCBI-ProteinID:  XP_009032358 JGI:  Auran1_17782 UniProt:  F0XW22 LinkDB All DBs Position Unknown AA seq 68 aa AA seqDB search DMSEEKVEFALDIAQEGFNQASFKGKVYSYIAQFIRAGFEKAYGKGWNVVVGRSFGAYVT HEIKTYMY NT seq 204 nt NT seq  +upstreamnt  +downstreamnt gacatgagcgaggagaaggtcgagttcgcgctggacatcgcccaggagggtttcaaccag gcgtccttcaagggcaaggtctactcctacatcgcccagttcatccgcgcgggcttcgag aaggcgtacggcaagggctggaacgtcgtcgtcggccggtccttcggcgcctacgtgacg cacgagatcaaaacctacatgtac

DBGET integrated database retrieval system