Aureococcus anophagefferens: AURANDRAFT_19207 Help Entry AURANDRAFT_19207  CDS       T04134                                  Name (RefSeq) hypothetical protein   KO K10418   dynein light chain LC8-type Organism aaf  Aureococcus anophagefferens Pathway aaf04145   Phagocytosis aaf04517   IgSF CAM signaling aaf04814   Motor proteins Brite KEGG Orthology (KO) [BR:aaf00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     AURANDRAFT_19207  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagocytosis     AURANDRAFT_19207   09142 Cell motility    04814 Motor proteins     AURANDRAFT_19207  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:aaf03037]     AURANDRAFT_19207    04812 Cytoskeleton proteins [BR:aaf04812]     AURANDRAFT_19207 Cilium and associated proteins [BR:aaf03037]  Motile cilia and associated proteins   Dynein arm    AURANDRAFT_19207 Cytoskeleton proteins [BR:aaf04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      AURANDRAFT_19207 SSDB OrthologParalogGFIT Motif Pfam:  Dynein_light Motif Other DBs NCBI-GeneID:  20219101 NCBI-ProteinID:  XP_009032663 JGI:  Auran1_19207 UniProt:  F0XW00 LinkDB All DBs Position Unknown AA seq 78 aa AA seqDB search DEHGEMKQEVYNLAAYAIEQYVTEMEVSKHIKAHFDQKYGPTWHCIVGSDFRAYVTHESK NFIFFYQGKTAICLYKCG NT seq 237 nt NT seq  +upstreamnt  +downstreamnt gacgagcacggcgagatgaagcaggaggtctacaacctcgccgcgtacgcgatcgagcag tacgtgacggagatggaggtgagcaagcacatcaaggcccacttcgaccagaagtacggg ccgacctggcattgcatcgtcggcagcgacttccgcgcctacgtgacgcacgagagcaaa aacttcatcttcttctaccaggggaagaccgcgatatgcctctacaagtgcggatga

DBGET integrated database retrieval system