Aureococcus anophagefferens: AURANDRAFT_29207 Help Entry AURANDRAFT_29207  CDS       T04134                                  Name (RefSeq) hypothetical protein   KO K03872   elongin-C Organism aaf  Aureococcus anophagefferens Pathway aaf04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:aaf00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     AURANDRAFT_29207  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:aaf04121]     AURANDRAFT_29207    03400 DNA repair and recombination proteins [BR:aaf03400]     AURANDRAFT_29207 Ubiquitin system [BR:aaf04121]  Ubiquitin ligases (E3)   Multi subunit type E3    Cul2 complex     Adoptor protein      AURANDRAFT_29207    Cul5 complex      AURANDRAFT_29207 DNA repair and recombination proteins [BR:aaf03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      AURANDRAFT_29207 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Skp1_POZ BTB Motif Other DBs NCBI-GeneID:  20220692 NCBI-ProteinID:  XP_009038876 JGI:  Auran1_29207 UniProt:  F0YER3 LinkDB All DBs Position Unknown AA seq 92 aa AA seqDB search SAEGHEFWVDRKCANTSGTIKAMLSGPRGPRQFTESSGEIKFPEISTPILEKVIQYFYYK LRYTNSQVRIPEFQIDPEMALELLMASNFLDC NT seq 279 nt NT seq  +upstreamnt  +downstreamnt agcgccgagggccacgagttctgggtcgaccgcaagtgcgcgaacacgtcgggcacgatc aaggccatgctctccggtccgcgcggcccgcgccagttcacggagagctccggcgagatc aagttcccggagatctcgacgcccatcctcgagaaggtcatccagtacttttactacaaa ctccgctacacgaacagccaggtccgcatcccggagttccagatcgaccccgagatggcg ctcgagctgctgatggcgagcaacttcctggactgttga

DBGET integrated database retrieval system