Aureococcus anophagefferens: AURANDRAFT_29507 Help Entry AURANDRAFT_29507  CDS       T04134                                  Name (RefSeq) hypothetical protein   KO K14965   protein dpy-30 Organism aaf  Aureococcus anophagefferens Brite KEGG Orthology (KO) [BR:aaf00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:aaf03036]     AURANDRAFT_29507 Chromosome and associated proteins [BR:aaf03036]  Eukaryotic type   Histone modification proteins    HMT complexes     COMPASS/SET1 complex      AURANDRAFT_29507     MLL-HCF complex      AURANDRAFT_29507     MLL3/MLL4 complex      AURANDRAFT_29507 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Dpy-30 Motif Other DBs NCBI-GeneID:  20220737 NCBI-ProteinID:  XP_009039005 JGI:  Auran1_29507 UniProt:  F0YEQ0 LinkDB All DBs Position Unknown AA seq 55 aa AA seqDB search MHVQSLPIRAYLDTTVVPILLDGMSALVKERPPNPVEWLATYLIKNNPQGSTANS NT seq 168 nt NT seq  +upstreamnt  +downstreamnt atgcacgtccagagtctgcccatccgcgcgtacctcgacacgaccgtcgtgccgatcctg ctcgacggcatgtccgcgctcgtcaaggagagaccaccgaacccggtagagtggctcgcc acctacctcatcaagaacaacccccagggctccacggccaacagctaa

DBGET integrated database retrieval system