Aureococcus anophagefferens: AURANDRAFT_33181 Help Entry AURANDRAFT_33181  CDS       T04134                                  Name (RefSeq) hypothetical protein   KO K12626   U6 snRNA-associated Sm-like protein LSm7 Organism aaf  Aureococcus anophagefferens Pathway aaf03018   RNA degradation aaf03040   Spliceosome Brite KEGG Orthology (KO) [BR:aaf00001]  09120 Genetic Information Processing   09121 Transcription    03040 Spliceosome     AURANDRAFT_33181   09123 Folding, sorting and degradation    03018 RNA degradation     AURANDRAFT_33181  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:aaf03019]     AURANDRAFT_33181    03041 Spliceosome [BR:aaf03041]     AURANDRAFT_33181 Messenger RNA biogenesis [BR:aaf03019]  Eukaryotic type   mRNA surveillance and transport factors    mRNA cycle factors     P-body specific factors      AURANDRAFT_33181   mRNA degradation factors    5'-3' decay     Lsm complex      AURANDRAFT_33181 Spliceosome [BR:aaf03041]  Complex B   U4/U6.U5 tri-snRNP components    LSm proteins     AURANDRAFT_33181 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  LSM DUF150_C Motif Other DBs NCBI-GeneID:  20221262 NCBI-ProteinID:  XP_009041305 JGI:  Auran1_33181 UniProt:  F0YLJ8 LinkDB All DBs Position Unknown AA seq 103 aa AA seqDB search MASKSIIDLEKCIDKEVRVKFQGGREVRGVLKGFDQLVNIVLDNCVESMHGASARAHPDD PYRLTDKTRKLGLVVCRGLQVSLVSPVDGMEEIANPFIQHSEI NT seq 312 nt NT seq  +upstreamnt  +downstreamnt atggcgtcgaagtcgatcatcgacctcgagaaatgcatcgataaagaagtccgcgtgaaa ttccagggcggccgcgaagtgcgcggcgtcctcaagggcttcgaccagctcgtgaacatc gtcctcgacaactgcgtcgagtccatgcacggcgcgtccgcccgcgcccaccccgacgac ccgtaccgcctcacggacaagacgcggaagctcggcctcgtcgtctgccgagggctccag gtgagcctcgtgtcgcccgtcgacggcatggaggagatcgcgaacccgttcatccagcac tccgagatctag

DBGET integrated database retrieval system