Aureococcus anophagefferens: AURANDRAFT_7175 Help Entry AURANDRAFT_7175   CDS       T04134                                  Name (RefSeq) hypothetical protein   KO K07305   peptide-methionine (R)-S-oxide reductase [EC:1.8.4.12] Organism aaf  Aureococcus anophagefferens Brite KEGG Orthology (KO) [BR:aaf00001]  09190 Not Included in Pathway or Brite   09191 Unclassified: metabolism    99980 Enzymes with EC numbers     AURANDRAFT_7175 Enzymes [BR:aaf01000]  1. Oxidoreductases   1.8  Acting on a sulfur group of donors    1.8.4  With a disulfide as acceptor     1.8.4.12  peptide-methionine (R)-S-oxide reductase      AURANDRAFT_7175 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  SelR At4g08330 Yippee-Mis18 Zn_ribbon_10 DZR Trm112p Zn_ribbon_4 Zn_ribbon_NUD Motif Other DBs NCBI-GeneID:  20228373 NCBI-ProteinID:  XP_009032876 JGI:  Auran1_7175 UniProt:  F0XZB1 LinkDB All DBs Position Unknown AA seq 98 aa AA seqDB search KYPQRGAFLCVQCGTPLYWARSKFGSGSGWPAFYDAVDGAVERVAESQQDPLSSELKQHG TELVCSNCGGHLGHVFEGEGFGTPTDERHCVNGVCLRY NT seq 294 nt NT seq  +upstreamnt  +downstreamnt aagtatccgcagcgcggcgcgttcctctgcgtccagtgcgggacgccgctctactgggcg cggagcaagttcggctccggcagcgggtggcccgcgttctacgacgccgtcgacggcgcc gtggagcgcgtcgccgagtcgcagcaggacccgctctcgagcgagctcaagcagcacggc acggagctggtctgttccaactgcggcggccatctcggccacgtcttcgagggcgagggc ttcggcacgccgacggacgagcgccactgcgtcaacggcgtctgcctgcgctac

DBGET integrated database retrieval system