Aureococcus anophagefferens: AURANDRAFT_8594 Help Entry AURANDRAFT_8594   CDS       T04134                                  Name (RefSeq) hypothetical protein   KO K11253   histone H3 Organism aaf  Aureococcus anophagefferens Brite KEGG Orthology (KO) [BR:aaf00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:aaf03036]     AURANDRAFT_8594   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:aaf04147]     AURANDRAFT_8594 Chromosome and associated proteins [BR:aaf03036]  Eukaryotic type   Nucleosome assembly factors    Histones     AURANDRAFT_8594 Exosome [BR:aaf04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    AURANDRAFT_8594 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone CENP-S CENP-T_C TFIID-31kDa CBFD_NFYB_HMF DUF7101 TAF Motif Other DBs NCBI-GeneID:  20229270 NCBI-ProteinID:  XP_009038978 JGI:  Auran1_8594 UniProt:  F0YEV9 LinkDB All DBs Position Unknown AA seq 98 aa AA seqDB search RRKHRKRPGQKALQEIRVYQRSTELLIRKLPFARLVREICNDETGNAEFRQASAISALQE ATEAHVVQLFEDANLCAIHGKRVTIMVKDIQLARRIRG NT seq 294 nt NT seq  +upstreamnt  +downstreamnt cgccggaagcaccggaagcgcccgggacagaaggcgctccaggagatccgcgtctaccag cggagcacggagctgctcatccgcaagctgccgttcgcgcggctcgtgcgcgagatctgc aacgatgaaaccggcaacgccgagttccggcaagcgtcggcgatctccgcgctccaggag gcgaccgaggcccacgttgtccagctcttcgaggacgccaacctctgcgcgatccacggg aagcgcgtgaccatcatggtcaaggacatccagctcgcgcgacgaatccgcggc

DBGET integrated database retrieval system