Aureococcus anophagefferens: AURANDRAFT_9374 Help Entry AURANDRAFT_9374   CDS       T04134                                  Name (RefSeq) hypothetical protein   KO K03358   anaphase-promoting complex subunit 11 Organism aaf  Aureococcus anophagefferens Pathway aaf04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:aaf00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     AURANDRAFT_9374  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:aaf04121]     AURANDRAFT_9374    03036 Chromosome and associated proteins [BR:aaf03036]     AURANDRAFT_9374 Ubiquitin system [BR:aaf04121]  Ubiquitin ligases (E3)   Multi subunit Ring-finger type E3    APC/C     Ring finger protein      AURANDRAFT_9374 Chromosome and associated proteins [BR:aaf03036]  Eukaryotic type   Sister chromatid separation proteins    APC/C complex     AURANDRAFT_9374 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  zf-ANAPC11 zf-rbx1 zf-RING_2 zf-C3HC4_2 zf-RING_UBOX zf-C3HC4_3 zf-C3HC4 zf-RING_5 zf-RING_4 Prok-RING_4 zf-RING_16 zf-RING_11 RH_dom zf-P11 zf-Nse zf-RING_6 zf-C3HC4_4 zf-RING-like PHD Rad50_zn_hook UBZ_FAAP20 Motif Other DBs NCBI-GeneID:  20229393 NCBI-ProteinID:  XP_009036599 JGI:  Auran1_9374 UniProt:  F0Y8G1 LinkDB All DBs Position Unknown AA seq 82 aa AA seqDB search LKVNILKWHAVARWTWGDDVDGDVCGICQMPFEGCPPGVLYPGDGAPVVWGKCGHAFHLQ CVSQWLSSKNSCPICRREWEFE NT seq 246 nt NT seq  +upstreamnt  +downstreamnt ctcaaggtgaacatcctcaagtggcacgccgtcgcccgctggacctggggcgacgacgtc gacggcgacgtctgcggcatctgccagatgcccttcgaggggtgccctcccggcgtgctc tatcccggcgacggcgcgcccgtcgtctggggcaagtgcggccacgccttccacctccag tgcgtgagccagtggctgagctcgaagaactcgtgccccatctgccgccgcgagtgggag ttcgag

DBGET integrated database retrieval system