KEGG   Aedes aegypti (yellow fever mosquito): 110674175
Entry
110674175         CDS       T01053                                 
Name
(RefSeq) cytochrome P450 306a1
  KO
K10720  ecdysteroid 25-hydroxylase [EC:1.14.-.-]
Organism
aag  Aedes aegypti (yellow fever mosquito)
Pathway
aag00981  Insect hormone biosynthesis
Brite
KEGG Orthology (KO) [BR:aag00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00981 Insect hormone biosynthesis
    110674175
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:aag00199]
    110674175
Enzymes [BR:aag01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.-
    1.14.-.-
     110674175
Cytochrome P450 [BR:aag00199]
 Cytochrome P450, animal type
  CYP306 family
   110674175
SSDB
Motif
Pfam: p450
Other DBs
NCBI-GeneID: 110674175
NCBI-ProteinID: XP_021693810
LinkDB
Position
1:complement(289399748..289443716)
AA seq 499 aa
MYLILGIVLILTYVLWTLLDRRGKPPGPFGLPILGYLPFIDSIKPYETLTNLAKRYGPVY
SLRMGQVDAVVLIAPDLIRDTLKREETTGRAPLFITHGIMGGHGIICAEGNLWRDQRRLS
TEWLRTMGMTKFGPTRATLEARILIGVNELLEDLRRESEKVFAFDPAPLLHHILGNLMND
IVFGLQYERDDATWRYLQHLQEEGVKHIGVSMAVNFLPFLRHLPSSKRIIEFLLNGKAKT
HKIYDSIIEKQRSRMEGGGSEVSDPGRHDDCILSNFLQETRRRETGARPELAFCSDVQLR
HLLADLFGAGVDTTFTTLRWLILFLALNKDAQERLRQEMASQLRGEPCLNDVDSLPYLKA
CVAEAQRLRTVVPLGIPHGAVSDIKIAGYKVSKNTMIIPLLWSVHMDPSLWPNPDRFDPE
HFLDESGQYSAPAHFMPFQTGKRMCLGDELARMILLLYTGRLFWHFELDVFNGEGLDLTG
VCGITLTPPPFEIIFKERV
NT seq 1500 nt   +upstreamnt  +downstreamnt
atgtacttaatcctcggcatcgtattaatcctgacttacgtactatggacactactggac
cgacgtggtaaacccccgggcccattcggtttaccgatcctcggatatctgcccttcatc
gactccatcaaaccgtacgaaacgcttacgaaccttgccaaacgctacggccccgtctac
agcctccggatgggccaggtggatgcagtcgttctcatcgcgccggacctcattcgggac
acgctcaagcgggaggaaacaaccggaagggccccgctcttcatcacccacgggataatg
ggaggacatggaatcatctgcgcagaaggcaatctatggcgggatcagcggcgtctttcg
accgaatggctgcgcacgatgggcatgacgaaattcggtccaacgcgtgcaacgctcgaa
gcccgcatcttaatcggtgtgaatgaacttttagaggatttgaggagggaatcggagaaa
gtgtttgccttcgatcctgcaccgttgctgcatcacattctaggaaatctgatgaatgac
atcgtctttgggctgcagtacgagcgggatgatgcaacgtggcgatatcttcagcatctc
caggaggaaggcgtcaagcatatcggagtttcgatggcggttaattttttaccgttttta
agacatctgccttcgagcaaaaggataattgaatttttattaaatggtaaagcaaaaacc
cataaaatttacgactcgatcatcgaaaagcagcgcagccgaatggaaggaggaggcagc
gaggtcagtgacccaggccggcacgacgattgcatcctgtcgaatttcctgcaggaaacc
cgtcgaagggaaaccggtgcccgtccggagctggccttctgtagcgacgtccagcttcgg
catctgctggcggatttgttcggggcaggtgtggacaccacctttacgacgcttcgctgg
ttgattctgtttctggccttgaacaaagacgcccaggagcggctcaggcaggagatggcc
agtcagcttcggggcgaaccgtgcttgaatgatgtggactcgttgccgtacctgaaagcg
tgcgtggccgaggcgcaacggttgagaacggtcgttccactcggtatccctcatggagct
gtatcggacatcaaaatcgccggctacaaggtatcgaaaaacaccatgatcatcccccta
ctatggtccgtccacatggacccctcactgtggcccaatccggaccgcttcgatccggaa
cacttcctggacgaatcgggccagtactccgccccggcccattttatgccgttccaaacc
ggcaagcggatgtgcctcggagacgaactggcccgcatgatcctattgctgtacaccggg
cgcctattttggcacttcgaactggacgtgttcaacggggaggggctggatttgacgggg
gtttgcggaataaccctcaccccgccgccgttcgagatcattttcaaggaacgtgtgtga

DBGET integrated database retrieval system