Aedes aegypti (yellow fever mosquito): 110677779 Help Entry 110677779         CDS       T01053                                  Name (RefSeq) NTF2-related export protein-like   KO K14285   NTF2-related export protein 1/2 Organism aag  Aedes aegypti (yellow fever mosquito) Pathway aag03008   Ribosome biogenesis in eukaryotes aag03013   Nucleocytoplasmic transport aag03015   mRNA surveillance pathway Brite KEGG Orthology (KO) [BR:aag00001]  09120 Genetic Information Processing   09122 Translation    03013 Nucleocytoplasmic transport     110677779    03015 mRNA surveillance pathway     110677779    03008 Ribosome biogenesis in eukaryotes     110677779  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:aag03019]     110677779    03009 Ribosome biogenesis [BR:aag03009]     110677779 Messenger RNA biogenesis [BR:aag03019]  Eukaryotic type   mRNA surveillance and transport factors    Transport factors     Nuclear pore complex      110677779 Ribosome biogenesis [BR:aag03009]  Eukaryotic type   Pre-60S particles    Export and cytoplasmic maturation factors     110677779 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  NTF2 Motif Other DBs NCBI-GeneID:  110677779 NCBI-ProteinID:  XP_021704913 LinkDB All DBs Position 1:complement(51845985..51846568) Genome browser AA seq 87 aa AA seqDB search MTTAIDPELRTKIDAACRMEEGFAKLYNEKVAKKRHQMTRLYMDNGLLVWNGNGANGKDN IQKYFQELPRFEYIMNTLAIIESSQGW NT seq 264 nt NT seq  +upstreamnt  +downstreamnt atgacaactgcgatcgacccagaactgcgcaccaaaatcgatgccgcttgccggatggag gagggattcgccaaactgtacaacgaaaaagtagccaagaagcggcatcagatgacccgg ctctacatggacaacggtttgctggtgtggaacggaaatggtgccaacgggaaggacaac atccagaagtacttccaggaactgccccgcttcgaatacattatgaacaccctggctata attgaatcatcgcagggctggtag

DBGET integrated database retrieval system