Aedes aegypti (yellow fever mosquito): 110681345 Help Entry 110681345         CDS       T01053                                  Name (RefSeq) histone H2A   KO K11251   histone H2A Organism aag  Aedes aegypti (yellow fever mosquito) Pathway aag03082   ATP-dependent chromatin remodeling Brite KEGG Orthology (KO) [BR:aag00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     110681345  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:aag03036]     110681345   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:aag04147]     110681345 Chromosome and associated proteins [BR:aag03036]  Eukaryotic type   Nucleosome assembly factors    Histones     110681345 Exosome [BR:aag04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    110681345 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_H2A_C Histone CBFD_NFYB_HMF Motif Other DBs NCBI-GeneID:  110681345 NCBI-ProteinID:  XP_021712785 LinkDB All DBs Position Unknown AA seq 124 aa AA seqDB search MSGRGKGGKVKGKAKSRSNRAGLQFPVGRIHRLLRKGNYAERVGAGAPVYLAAVMEYLAA EVLELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLSGVTIAQGGVLPNIQAVLLPKKT EKKA NT seq 375 nt NT seq  +upstreamnt  +downstreamnt atgtctggccgcggcaaaggaggcaaagttaagggaaaggcaaagtcccgttccaaccgg gcaggattgcagttcccggtcggtcgtatccaccgtctgctcaggaagggcaactacgcc gagcgagttggtgctggcgctccagtctacttggctgccgtcatggaatatctggctgct gaagttctggaattggcgggaaacgctgctcgtgataacaagaagaccagaatcattccc cgtcatctgcagttggccatccgtaacgatgaggaattgaacaaactgctgtctggcgtt accattgcacagggtggtgtgttgccaaacattcaggctgttctgttgcccaagaaaacc gaaaagaaggcctaa

DBGET integrated database retrieval system