Aedes aegypti (yellow fever mosquito): 5563664 Help Entry 5563664           CDS       T01053                                  Name (RefSeq) elongin-B   KO K03873   elongin-B Organism aag  Aedes aegypti (yellow fever mosquito) Pathway aag04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:aag00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     5563664  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:aag04121]     5563664    03400 DNA repair and recombination proteins [BR:aag03400]     5563664 Ubiquitin system [BR:aag04121]  Ubiquitin ligases (E3)   Multi subunit type E3    Cul2 complex     Adoptor protein      5563664    Cul5 complex      5563664 DNA repair and recombination proteins [BR:aag03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      5563664 SSDB OrthologParalogGFIT Motif Pfam:  ubiquitin Rad60-SLD GABP-alpha Motif Other DBs NCBI-GeneID:  5563664 NCBI-ProteinID:  XP_001647846 UniProt:  Q0C7C3 A0A1S4EUX3 LinkDB All DBs Position 1 Genome browser AA seq 118 aa AA seqDB search MDVFMMIRRKKTTIFTDAKETTPVHELKRMIEGIIKVPPRDQRLYNKDNQLMDDDRTLQD CGITVSTAKAQCPAQLGLAIRENSGDFEQLDLTPYSLPPDLPDVMKNQDAANGQDQLA NT seq 357 nt NT seq  +upstreamnt  +downstreamnt atggatgtcttcatgatgatcagacggaagaagaccaccatcttcaccgatgccaaagaa acgacgccggtgcacgagctgaaacgaatgatcgaaggaatcatcaaagtgcctccccgg gaccagcgcctgtacaacaaggacaaccagctgatggacgacgaccggaccctgcaggac tgtggcatcacggtgtccaccgccaaggcacagtgcccggcccagctcgggttggccatc cgggaaaacagcggcgacttcgagcagctggatctgactccgtactcgctgccgccagat ctacccgacgtgatgaagaaccaggacgcggccaacggacaggatcagcttgcctaa

DBGET integrated database retrieval system