Aedes aegypti (yellow fever mosquito): 5567130 Help Entry 5567130           CDS       T01053                                  Name (RefSeq) calmodulin-beta   KO K02183   calmodulin Organism aag  Aedes aegypti (yellow fever mosquito) Pathway aag04070   Phosphatidylinositol signaling system aag04745   Phototransduction - fly Brite KEGG Orthology (KO) [BR:aag00001]  09130 Environmental Information Processing   09132 Signal transduction    04070 Phosphatidylinositol signaling system     5567130  09150 Organismal Systems   09157 Sensory system    04745 Phototransduction - fly     5567130  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:aag01009]     5567130   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:aag04131]     5567130    03036 Chromosome and associated proteins [BR:aag03036]     5567130   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:aag04147]     5567130 Protein phosphatases and associated proteins [BR:aag01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      5567130 Membrane trafficking [BR:aag04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     5567130 Chromosome and associated proteins [BR:aag03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      5567130 Exosome [BR:aag04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    5567130 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_5 EF-hand_8 EH EF-hand_9 EF-hand_FSTL1 AIF-1 SPARC_Ca_bdg Dockerin_1 DUF5580_M EF_EFCAB10_C Caleosin FCaBP_EF-hand SAPC2_N DUF6692 EF-hand_11 RTX_C RPN13_C EF-hand_EFHB_C RNA_pol_Rpb4 Motif Other DBs NCBI-GeneID:  5567130 NCBI-ProteinID:  XP_001651555 UniProt:  A0A1S4FBU1 Q178H5 LinkDB All DBs Position Unknown AA seq 149 aa AA seqDB search MSAHSLTEEQGRQFRQMFEMFDKNGDGSISTSELGSVIRALGMNPSIAEIEQMIHEVDLD GSGSIELNEFLILMARKSREGSTQEELRDAFKIFDKDGDGFLTVDELSAVMKNFGERLTD DELADLLEEADIDGDGKINYEEFVIMLSK NT seq 450 nt NT seq  +upstreamnt  +downstreamnt atgtccgcccatagtctaacagaggaacaagggcgccagttccgtcagatgttcgagatg ttcgacaaaaatggcgacggttcgatcagcacatcggaactgggatcggtcattcgggcc ttgggtatgaatccctccattgcggaaatcgagcaaatgatccacgaggtcgatttggac ggaagtgggtcgattgagttgaacgaatttctcatactgatggcacgtaagtcacgggag ggttccacacaggaagagctacgggatgcgttcaaaatttttgacaaggatggagatgga tttctcacggttgacgagttgtcggctgttatgaagaactttggcgagagattgaccgat gacgaactagcagatctgctggaggaagccgacatcgatggagacggaaagatcaactat gaagaatttgtcatcatgttgagcaagtga

DBGET integrated database retrieval system