Aedes aegypti (yellow fever mosquito): 5572347 Help Entry 5572347           CDS       T01053                                  Name (RefSeq) ras-related protein Rac1   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism aag  Aedes aegypti (yellow fever mosquito) Pathway aag04013   MAPK signaling pathway - fly aag04145   Phagosome aag04148   Efferocytosis aag04310   Wnt signaling pathway aag04517   IgSF CAM signaling aag04518   Integrin signaling aag04620   Toll-like receptor signaling pathway aag05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:aag00001]  09130 Environmental Information Processing   09132 Signal transduction    04013 MAPK signaling pathway - fly     5572347    04310 Wnt signaling pathway     5572347   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     5572347    04518 Integrin signaling     5572347  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     5572347    04148 Efferocytosis     5572347  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     5572347  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     5572347  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:aag04131]     5572347   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:aag04147]     5572347    04031 GTP-binding proteins [BR:aag04031]     5572347 Membrane trafficking [BR:aag04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     5572347  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     5572347   Macropinocytosis    Ras GTPases     5572347  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     5572347 Exosome [BR:aag04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    5572347   Exosomal proteins of other body fluids (saliva and urine)    5572347   Exosomal proteins of colorectal cancer cells    5572347   Exosomal proteins of bladder cancer cells    5572347 GTP-binding proteins [BR:aag04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     5572347 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Motif Other DBs NCBI-GeneID:  5572347 NCBI-ProteinID:  XP_001660306 UniProt:  Q16V03 LinkDB All DBs Position 2:68615478..68629091 Genome browser AA seq 192 aa AA seqDB search MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPINLGLWDTAG QEDYDRLRPLSYPQTDVFLICFSLVNPASFENVRAKWYPEVRHHCPNIPIILVGTKLDLR DDKQTVDKLREKKLSPITYPQGLAMAKEIGAVKYLECSALTQKGLKTVFDEAIRAVLCPI IPVKNKRKCSIL NT seq 579 nt NT seq  +upstreamnt  +downstreamnt atgcaggccatcaagtgcgtcgtagtcggagatggtgccgtgggtaagacctgtctgttg atcagctacacgaccaatgccttcccgggagaatacattccgaccgtgttcgacaactat tcggccaacgtcatggtcgacgggaagccaatcaatctgggactgtgggatacggctgga caggaagattacgatcgtctccggccactttcctacccacagacggacgtgtttctcata tgcttctcgctggtaaatccggcctcgtttgaaaacgttcgggccaagtggtacccggag gtacgtcaccattgtccgaacataccgataatcctcgttggaaccaagctcgatcttcgg gatgacaagcaaaccgtggataagctacgcgaaaagaagctctcgcccatcacctacccc cagggattggccatggccaaggaaatcggtgccgtcaagtatttggaatgttctgccctg acacagaaggggctcaaaaccgttttcgacgaagcgatccgtgccgttctctgtcccatc ataccggtgaaaaacaaacgtaaatgttcaattctgtaa

DBGET integrated database retrieval system