Aedes aegypti (yellow fever mosquito): 5574558 Help Entry 5574558           CDS       T01053                                  Name (RefSeq) eclosion hormone   KO K28249   eclosion hormone Organism aag  Aedes aegypti (yellow fever mosquito) Brite KEGG Orthology (KO) [BR:aag00001]  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:aag04052]     5574558 Cytokines and neuropeptides [BR:aag04052]  Neuropeptides   Unclassified    5574558 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Eclosion DUF7327 Motif Other DBs NCBI-GeneID:  5574558 NCBI-ProteinID:  XP_001661508 UniProt:  Q16QN2 LinkDB All DBs Position 3:238923884..238924432 Genome browser AA seq 90 aa AA seqDB search MASVRIVALFIAIALAVVLVSEASANPQIDILGGYDMIGVCINNCAQCKKMFGEFFEGHL CAEACIQFKGKMVPDCEDINSIAPFLNKLN NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atggcttcagtaagaatagttgcacttttcattgcgattgcattggcagttgtgttggtt tctgaagcaagcgcaaatcctcaaattgatatcctaggcggatacgatatgatcggagtc tgcatcaacaactgcgcccagtgcaagaaaatgttcggcgagttcttcgaaggccatctg tgtgctgaagcctgcatccagttcaagggcaaaatggtaccagactgtgaagatatcaat tcgatcgctccgttcttgaacaaactgaactag

DBGET integrated database retrieval system