Aedes aegypti (yellow fever mosquito): 5575645 Help Entry 5575645           CDS       T01053                                  Name (RefSeq) calmodulin   KO K02183   calmodulin Organism aag  Aedes aegypti (yellow fever mosquito) Pathway aag04070   Phosphatidylinositol signaling system aag04745   Phototransduction - fly Brite KEGG Orthology (KO) [BR:aag00001]  09130 Environmental Information Processing   09132 Signal transduction    04070 Phosphatidylinositol signaling system     5575645  09150 Organismal Systems   09157 Sensory system    04745 Phototransduction - fly     5575645  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:aag01009]     5575645   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:aag04131]     5575645    03036 Chromosome and associated proteins [BR:aag03036]     5575645   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:aag04147]     5575645 Protein phosphatases and associated proteins [BR:aag01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      5575645 Membrane trafficking [BR:aag04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     5575645 Chromosome and associated proteins [BR:aag03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      5575645 Exosome [BR:aag04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    5575645 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  EF-hand_7 EF-hand_6 CFAP251_C AIF-1 AAA_SpoVK_2nd EF-hand_SWAP70_N TFIIE_beta Motif Other DBs NCBI-GeneID:  5575645 NCBI-ProteinID:  XP_001655791 UniProt:  A0A1S4FUW2 Q16NH0 LinkDB All DBs Position 1:285608567..285609942 Genome browser AA seq 149 aa AA seqDB search MARYFKEQDIDEFRECFYLFARSGHITTLDELTVIMRSLGLSPTIQELTSYLKKKNGRMS FADFLEVIHQHSRVENLPEEVIEAFKAGDKSGRGTIPARQLRHLLQNWGEGLSFREVDNI FREANVSSNGQVRYADFVRVACAPVPDYY NT seq 450 nt NT seq  +upstreamnt  +downstreamnt atggcccgttacttcaaagagcaagacatcgatgagttccgtgagtgtttctatctgttt gcccgcagcggacacatcaccaccctggacgagctgaccgtgataatgcgatcgctggga ctatctcccacaatccaggagttgacctcgtatctgaaaaagaaaaatggccgcatgagt tttgccgactttctggaggtgatccaccagcactcgcgggtcgagaatctcccggaggag gtaatcgaggcgttcaaggctggggacaagagcggtcgtggcaccattccggcccggcag ctgcgccatttgttgcagaactggggcgaggggttgtctttcagagaggtggataacatt tttcgggaagcgaatgtttccagcaatggtcaggttcgctatgccgatttcgtacgggtt gcttgtgctcctgttccggattattactag

DBGET integrated database retrieval system