Aedes aegypti (yellow fever mosquito): 5578234 Help Entry 5578234           CDS       T01053                                  Name (RefSeq) synaptobrevin isoform X3   KO K13504   vesicle-associated membrane protein 2 Organism aag  Aedes aegypti (yellow fever mosquito) Pathway aag04130   SNARE interactions in vesicular transport aag04145   Phagocytosis Brite KEGG Orthology (KO) [BR:aag00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04130 SNARE interactions in vesicular transport     5578234  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagocytosis     5578234  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:aag04131]     5578234 Membrane trafficking [BR:aag04131]  SNARE   VAMP, Ykt6, Sec22 (R)    VAMP     5578234  Endoplasmic reticulum (ER) - Golgi transport   Forward pathways    Rab associated proteins     5578234 SSDB OrthologParalogGFIT Motif Pfam:  Synaptobrevin MCU DUF2970 Tuftelin_like SpoIIM DUF2976 DUF1676 YqfQ Orf78 Seryl_tRNA_N DUF2207_C T2SSF Motif Other DBs NCBI-GeneID:  5578234 NCBI-ProteinID:  XP_001663759 UniProt:  Q16IR6 LinkDB All DBs Position 2 Genome browser AA seq 114 aa AA seqDB search MSAPEGSSNGTQPAASSANGAAANRLKQTQAQVDEVVGIMRVNVEKVLERDQKLSELDQR ADALQHGASQFEQQAGKLKRKQWWANMKMMIIMGIIGVVLLIIIILWLVPNDSN NT seq 345 nt NT seq  +upstreamnt  +downstreamnt atgtctgctcctgagggatcatcaaatggcacccagcccgcggccagcagcgccaacgga gcggcggccaaccgactaaagcaaacccaagcccaggtggacgaagtggtcggcatcatg cgcgtcaacgtcgagaaggtactcgagcgggatcagaaactttccgaactggaccaacgg gcagacgcactgcagcacggagcgtcccagttcgagcagcaggccggcaagctcaagcgg aagcagtggtgggccaacatgaagatgatgatcatcatgggcatcatcggagtggtcctg ctaattatcatcatcctttggctcgtccccaatgattcgaactag

DBGET integrated database retrieval system