Aedes aegypti (yellow fever mosquito): 5578276 Help Entry 5578276           CDS       T01053                                  Name (RefSeq) ras-related protein rab7   KO K07897   Ras-related protein Rab-7A Organism aag  Aedes aegypti (yellow fever mosquito) Pathway aag04137   Mitophagy - animal aag04140   Autophagy - animal aag04144   Endocytosis aag04145   Phagosome aag04148   Efferocytosis Brite KEGG Orthology (KO) [BR:aag00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     5578276    04145 Phagosome     5578276    04140 Autophagy - animal     5578276    04137 Mitophagy - animal     5578276    04148 Efferocytosis     5578276  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:aag04131]     5578276   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:aag04147]     5578276    04031 GTP-binding proteins [BR:aag04031]     5578276 Membrane trafficking [BR:aag04131]  Endosome - Lysosome transport   Rab GTPases and associated proteins    Rab GTPases     5578276 Exosome [BR:aag04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    5578276   Exosomal proteins of other body fluids (saliva and urine)    5578276   Exosomal proteins of colorectal cancer cells    5578276   Exosomal proteins of bladder cancer cells    5578276 GTP-binding proteins [BR:aag04031]  Small (monomeric) G-proteins   Rab Family    Rab7/9 [OT]     5578276 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 GTP_EFTU Gtr1_RagA RsgA_GTPase ATP_bind_1 nSTAND3 SRPRB cobW Septin AAA_16 Motif Other DBs NCBI-GeneID:  5578276 NCBI-ProteinID:  XP_001663804 UniProt:  A0A1S4F4T6 Q17F70 LinkDB All DBs Position 1:230209412..230244990 Genome browser AA seq 208 aa AA seqDB search MATRKKVLLKVIILGDSSVGKTSLMNQYVTKRFSNQYKATIGADFLTKEVVIDDRVVTMQ IWDTAGQERFQSLGVAFYRGADCCVLVYDTTAPNTFKNLDSWRDEFLIQASPRDPDHFPF VVLGNKIDLENRAVSTKRAQQWCQAKNDIPYFETSAKEGINVDLAFQTIAKNALAQESEV ELYNEFPDQIKLNADRNNRPRNGDNCSC NT seq 627 nt NT seq  +upstreamnt  +downstreamnt atggcaactaggaaaaaggtcctgctgaaagtgataatccttggcgacagcagcgtcggc aagacgtcgctcatgaaccagtatgttacgaagcgcttctcgaaccaatacaaagccacg atcggcgctgatttcctgacaaaggaagtggtgatcgacgatcgagtggtgacgatgcag atttgggacactgccggtcaggaacggttccaatcattgggggtggcattctaccgcgga gcagattgttgcgtactagtatacgatacaacggcgcccaatacgttcaaaaatctcgac tcctggcgggacgagtttctaatccaggcaagcccacgagatcccgaccacttcccgttc gtggtgcttggcaacaaaatcgatttggagaacagggccgtgtccacgaaacgtgcccag cagtggtgccaagccaagaacgatattccctatttcgaaacgtcagccaaggaaggcatc aatgtagatctggcgttccaaacgattgccaaaaacgcgttagcccaggagagtgaggtt gaactgtacaacgagttccccgatcaaatcaagctgaacgcggaccgcaacaatcggcct cgaaacggagacaactgctcgtgctaa

DBGET integrated database retrieval system