Aedes aegypti (yellow fever mosquito): 5578472 Help Entry 5578472           CDS       T01053                                  Name (RefSeq) histone H2B   KO K11252   histone H2B Organism aag  Aedes aegypti (yellow fever mosquito) Brite KEGG Orthology (KO) [BR:aag00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:aag03036]     5578472   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:aag04147]     5578472 Chromosome and associated proteins [BR:aag03036]  Eukaryotic type   Nucleosome assembly factors    Histones     5578472 Exosome [BR:aag04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    5578472 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone Motif Other DBs NCBI-GeneID:  5578472 NCBI-ProteinID:  XP_021712782 LinkDB All DBs Position Unknown AA seq 86 aa AA seqDB search MAPKTSGKAAKKSGKARRTLSRADKKKKKQRRKESYAIYIYKVLKQVHPDTGRFFKGYEH HEQLRELAKHAVSEGTKAVTKYTSSK NT seq 261 nt NT seq  +upstreamnt  +downstreamnt atggcaccgaaaaccagtggaaaggccgcgaagaaatccggcaaggccagaagaacattg tcaagggccgacaagaagaagaagaagcagcgcaggaaggagagctatgccatctacatc tacaaggtgttgaagcaagtccatcccgacactgggcgtttcttcaaaggctatgagcat catgaacagcttcgagaattggctaagcatgctgtttccgaaggcaccaaggccgtcacc aagtacaccagctccaagtaa

DBGET integrated database retrieval system