Aedes aegypti (yellow fever mosquito): 5578473 Help Entry 5578473           CDS       T01053                                  Name (RefSeq) histone H2A   KO K11251   histone H2A Organism aag  Aedes aegypti (yellow fever mosquito) Pathway aag03082   ATP-dependent chromatin remodeling Brite KEGG Orthology (KO) [BR:aag00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     5578473  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:aag03036]     5578473   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:aag04147]     5578473 Chromosome and associated proteins [BR:aag03036]  Eukaryotic type   Nucleosome assembly factors    Histones     5578473 Exosome [BR:aag04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    5578473 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_H2A_C ParE_like Motif Other DBs NCBI-GeneID:  5578473 NCBI-ProteinID:  XP_021706422 LinkDB All DBs Position 3:complement(161202259..161202573) Genome browser AA seq 87 aa AA seqDB search MSGRGKGGKVKGKAKSRSNRAGLQFPVGRIHRLLRKGNYAERVGAGAPVYVITERPESFP VICSWPSGGVLPNIQAVLLPKKTEKKA NT seq 264 nt NT seq  +upstreamnt  +downstreamnt atgtctggccgcggcaaaggaggcaaagttaagggaaaggcaaagtcccgttccaaccgg gcaggattgcagttcccggtcggtcgtatccaccgtctgctcaggaagggcaactacgcc gagcgagttggtgctggcgctccagtctacgtgataacagaaagaccagaatcattcccc gtcatctgcagttggccatccggtggtgtgttgccaaacattcaggctgttctgttgccc aagaaaaccgaaaagaaggcctaa

DBGET integrated database retrieval system