Aricia agestis (brown argus): 121725260 Help Entry 121725260         CDS       T09904                                  Name (RefSeq) elongin-B isoform X1   KO K03873   elongin-B Organism aage  Aricia agestis (brown argus) Pathway aage04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:aage00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     121725260  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:aage04121]     121725260    03400 DNA repair and recombination proteins [BR:aage03400]     121725260 Ubiquitin system [BR:aage04121]  Ubiquitin ligases (E3)   Multi subunit type E3    Cul2 complex     Adoptor protein      121725260    Cul5 complex      121725260 DNA repair and recombination proteins [BR:aage03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      121725260 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ubiquitin Rad60-SLD Motif Other DBs NCBI-GeneID:  121725260 NCBI-ProteinID:  XP_041968061 LinkDB All DBs Position 3:14247392..14264414 Genome browser AA seq 119 aa AA seqDB search MDVFLMIRRKKLTIFTDAKDTTTVLELKKMIEGILKVAPPNQMLFNKDSQLMEDDKTLAD YGLTSATAKAQCPAPIGLALRKESGEFEALDLTPYSSPPDLPDVMKSQETNGQEQMDQH NT seq 360 nt NT seq  +upstreamnt  +downstreamnt atggatgtctttttaatgattaggcgaaaaaaattaaccatcttcacggatgccaaagat actactactgttttagagctgaagaaaatgatagaaggcatactaaaggttgcaccaccg aatcaaatgcttttcaataaagatagccaacttatggaggatgacaagaccctggcagat tatggactgacatcagctacagctaaggcacagtgtcctgcaccaattggccttgctcta aggaaggaatctggcgaatttgaggctctcgatctgacaccatactcttccccaccggat ctaccagacgtcatgaaatctcaggaaacaaacggacaggaacagatggatcaacactaa

DBGET integrated database retrieval system