Aricia agestis (brown argus): 121729272 Help Entry 121729272         CDS       T09904                                  Name (RefSeq) ubiquitin-like protein 5   KO K13113   ubiquitin-like protein 5 Organism aage  Aricia agestis (brown argus) Brite KEGG Orthology (KO) [BR:aage00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03041 Spliceosome [BR:aage03041]     121729272   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:aage04052]     121729272 Spliceosome [BR:aage03041]  Complex B   Other components    Complex B specific factors     121729272 Cytokines and neuropeptides [BR:aage04052]  Neuropeptides   Unclassified    121729272 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ubiquitin Ubiquitin_2 Crinkler PI3K_rbd OTU1_UBXL Ubiquitin_4 Motif Other DBs NCBI-GeneID:  121729272 NCBI-ProteinID:  XP_041973669 LinkDB All DBs Position 8:complement(17426963..17428266) Genome browser AA seq 73 aa AA seqDB search MLEVTCNDRLGKKVRVKCNPDDTVGDLKKLIAAQTGTRYDKIVLKKWYTVFKDHIKLSDY EIHDGMNLELYYQ NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atgttagaagtcacatgcaatgatcgtcttgggaagaaagttagagtaaaatgtaatcct gatgatacagtgggtgatttgaaaaagcttatagcggcacaaactggtacaagatacgac aaaattgttctcaagaagtggtacaccgtcttcaaggatcacattaaactttcggattat gaaatccatgatggaatgaatttggagctgtactatcaatag

DBGET integrated database retrieval system