Aricia agestis (brown argus): 121737801
Help
Entry
121737801 CDS
T09904
Name
(RefSeq) translocator protein-like
KO
K05770
translocator protein
Organism
aage
Aricia agestis (brown argus)
Pathway
aage04080
Neuroactive ligand-receptor interaction
aage04214
Apoptosis - fly
Brite
KEGG Orthology (KO) [BR:
aage00001
]
09130 Environmental Information Processing
09133 Signaling molecules and interaction
04080 Neuroactive ligand-receptor interaction
121737801
09140 Cellular Processes
09143 Cell growth and death
04214 Apoptosis - fly
121737801
09180 Brite Hierarchies
09183 Protein families: signaling and cellular processes
02000 Transporters [BR:
aage02000
]
121737801
Transporters [BR:
aage02000
]
Other transporters
Others
121737801
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
TspO_MBR
DUF3262
Motif
Other DBs
NCBI-GeneID:
121737801
NCBI-ProteinID:
XP_041985437
LinkDB
All DBs
Position
21:10010801..10014839
Genome browser
AA seq
169 aa
AA seq
DB search
MFNWNLIGSIILPNIGGWAGAITTAGQMKNENGTAWYQTLEKPSWNPPNWLFGPAWTVLY
CGMGFASYLVWRDCGGFTKKSILPLVLYGGQLVLNWTWTPVFFRLHQIGLALIHIFLLDA
AAAACTASFIAVNKNTAYFMVPYLAWLCFATTLNYSIWQLNKDDGENYK
NT seq
510 nt
NT seq
+upstream
nt +downstream
nt
atgttcaactggaatctaattggaagtatcatattgccaaatatcggcggatgggcaggc
gctattaccacggctggtcagatgaaaaacgaaaatggtaccgcttggtaccaaacctta
gagaaaccgagttggaacccgcccaactggctgtttggaccagcgtggaccgtcttgtac
tgtggtatgggcttcgcgtcttacttggtctggagagactgtggaggtttcacaaaaaaa
tcaatactaccattggttttatatggtggccaacttgtcctgaactggacgtggacacct
gtgttcttcagattgcatcagattggcttggcgttaattcacatattcctgttagacgcg
gcggctgcagcgtgcacggctagcttcatagcggtcaacaaaaacacagcttacttcatg
gtgccttacctagcctggctttgctttgccaccactctaaactactccatatggcaattg
aacaaggatgatggcgagaattataaataa
DBGET
integrated database retrieval system