Glutamicibacter arilaitensis: AARI_25760 Help Entry AARI_25760        CDS       T01320                                  Symbol hup Name (GenBank) DNA-binding protein HU   KO K03530   DNA-binding protein HU-beta Organism aai  Glutamicibacter arilaitensis Brite KEGG Orthology (KO) [BR:aai00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:aai03032]     AARI_25760 (hup)    03036 Chromosome and associated proteins [BR:aai03036]     AARI_25760 (hup)    03400 DNA repair and recombination proteins [BR:aai03400]     AARI_25760 (hup) DNA replication proteins [BR:aai03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     AARI_25760 (hup) Chromosome and associated proteins [BR:aai03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     AARI_25760 (hup) DNA repair and recombination proteins [BR:aai03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       AARI_25760 (hup) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG DUF2267 Motif Other DBs NCBI-ProteinID:  CBT76789 LinkDB All DBs Position complement(2891576..2891860) Genome browser AA seq 94 aa AA seqDB search MAMNRSELVAAVAAKTENSQVAVNGVLDAVFEVFVDQISKGEKVSIPGWLAVERTDRAAR TGRNPQTGEAIQIPAGHSVKLTAGSKLKAAVAKK NT seq 285 nt NT seq  +upstreamnt  +downstreamnt ttggctatgaaccgtagcgaacttgttgctgctgttgcagcgaagaccgaaaactcccag gttgccgtcaacggtgttctggatgcagtcttcgaggttttcgtcgaccagatttccaag ggtgagaaggtttcgatcccaggttggttggctgtagagcgcaccgaccgtgcagctcgt accggccgcaacccacagaccggcgaagcgatccagattcctgcaggccactcggtcaag ctgaccgctggctcgaagctgaaggctgctgtagcaaagaagtaa

DBGET integrated database retrieval system