KEGG   Glutamicibacter arilaitensis: AARI_30950
Entry
AARI_30950        CDS       T01320                                 
Name
(GenBank) cation-transporting ATPase
  KO
K17686  P-type Cu+ transporter [EC:7.2.2.8]
Organism
aai  Glutamicibacter arilaitensis
Brite
Enzymes [BR:aai01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.2.2.8  P-type Cu+ transporter
     AARI_30950
SSDB
Motif
Pfam: E1-E2_ATPase Hydrolase HMA Hydrolase_3 HAD
Other DBs
NCBI-ProteinID: CBT77299
UniProt: A0ABM9Q0Q5
LinkDB
Position
3468060..3470318
AA seq 752 aa
MTSPAPHETRAEPRTVELDIQGMTCASCVNRVERKLGKLPGVSASVNLPLETAKVQVPAD
ISDETLISTVAAAGYTASLKQPAKPAHADHAGPGEEDHGGHEHLVPENLLRRLIVSSVFT
IPLFIISMIPGAQFPHWGWVAFALATPVVFYGAWPFHKAAAINARHFASTMDTLVSLGVL
AAYLFSAIQLILDPQMTAHTGMSMSEHALYFETAGVVATLLLLGRFLEHRAKSSASDALK
SLLSLGAKDAVVLRDGKEARIPAEQVQVGDHFVVRPGEKIATDGVVVDGASAVDTSLLTG
ESVPQKVGAGDEVTGATLNTSGRLVIEATRIGSDTTLAQMGKLVSEAQSGKAPIARLADR
ISAVFVPIVLAIAVLTFAIWFFTSGDTYQAFTAAVAVLVIACPCALGLATPIGLLVGTGR
GAQLGILIRGPQVLEDTRKLDTIVLDKTGTVTTGVMTHLGTEAIDGISPDEALMLAGAVE
HHSEHPIAQAIAKAAAELGPLPQASGFDSDPGGGVLGMVNGHHVVVGRHSWLELQGTVLD
ATAMAMLEEAEQSGATAILVSVDQQFQAVISVADKIKDTSAKAIGELQDRGLRVVLLTGD
NKSVATKVAAQVGIKAEDVFAGVFPADKAKAITALQEQGKVVAMVGDGVNDAPALAQADL
GIAMGSGTDVAIEAADITLMGNDLHQVTQAIDLSAKTLSTIKMNLFWAFAYNTAGIPIAA
LGLLNPMIAGAAMAASSVLVVLNSLRLRSFGK
NT seq 2259 nt   +upstreamnt  +downstreamnt
atgacttcccctgccccgcacgaaacccgcgcggaaccccgcacagtcgagctggatatc
cagggaatgacctgtgcatcctgcgtgaaccgcgtggaacgaaaactcggcaagctgccc
ggcgtcagcgcatcggtgaatctgccgctggagaccgccaaggtccaggttccggcagat
atcagcgacgaaacgctgatcagcaccgttgccgcagccggctacaccgcttcgctgaag
cagcctgcgaagccggcgcacgcagatcatgcggggccgggagaagaagaccacggcgga
cacgagcatctggttccagagaatctgctgcggcgcctgatcgtatcttcggtcttcacc
atcccgctcttcatcatttccatgattcccggggcccagttcccgcactggggctgggtt
gccttcgcactagccaccccggtggtcttctatggcgcgtggccattccacaaggccgcg
gcgatcaacgcacggcacttcgcctccaccatggacaccttggtgtccttgggcgtgctc
gccgcctacctcttctcggccattcagctgatcctggatccgcagatgaccgcgcacacc
ggcatgtcgatgtccgaacacgcactgtacttcgaaaccgccggcgtggtggctaccttg
ctgctgctgggccgcttcctggagcaccgggcgaagtcttcggcatccgatgccctgaaa
tcattgctgagcttgggtgccaaggacgcggtcgtgctgcgcgatggcaaggaagcgagg
attccggccgagcaggtccaggtgggagatcacttcgtggtgcgcccgggtgagaagatc
gccaccgacggcgtggtcgttgacggcgcaagcgccgtggacacctcgctgctgaccggc
gaatcagttccgcaaaaggtaggtgccggcgacgaggtcaccggcgcaacgctgaacacc
tccggacgcctggtcatcgaagccacccgcattggctccgacaccactttggcgcagatg
ggcaagttggtctccgaagcccaatcgggcaaggctcctatcgcccggctggccgacagg
atctccgcagtcttcgtgcccatcgtcttggccattgccgttctcaccttcgccatctgg
ttcttcaccagtggcgatacttatcaggcattcaccgccgcggtggcagttctagtcatc
gcctgcccttgcgcccttggcctggcaaccccgatcggcttgctggtgggcactggacgc
ggcgcgcagcttggcatcttaatccgtggcccccaggtcctggaagatacccgaaagctg
gacaccattgtgcttgataagaccggaaccgttaccaccggcgtcatgacccacctgggc
accgaagccatcgatggcatcagccccgatgaagccctgatgctggccggcgctgtggag
caccattccgagcatccgattgcccaggccatcgccaaggcggcagccgaattgggcccg
ttgccacaggccagcggcttcgactcggatccgggcggcggcgtgctcggcatggtcaac
ggccatcacgtagtcgtaggccggcacagctggctggaactgcagggcaccgttctggac
gccactgcgatggccatgctggaagaagccgaacagtctggcgctaccgccatcctggtc
tcggtagaccagcagttccaggccgtgatctcggtagcagataagatcaaggacacctcg
gccaaggcgattggcgaacttcaggaccgcggcctgcgcgtagtgctgctgaccggcgat
aacaagtcggtggcaaccaaggtcgccgcacaggtaggcatcaaggcggaggatgtcttt
gccggggtcttcccagcagacaaggccaaggcgatcaccgccctgcaagagcaaggcaag
gtcgtggccatggtaggtgatggcgtgaatgacgctccggcgctggcccaggccgatcta
ggcatcgccatgggttctggtaccgatgtggccatcgaggcagctgacatcaccttgatg
ggcaacgacttgcatcaggtcacccaggccatcgatttgtcggccaagaccctgtccacc
atcaagatgaacctgttctgggctttcgcctacaacaccgcaggcatcccgattgcggcc
ttggggctgctcaatccgatgatcgccggagccgcgatggcagccagctcggtgctggtg
gtcctcaactccctgcgtctgcgcagtttcggaaaataa

DBGET integrated database retrieval system