Aeromonas hydrophila MX16A: BOQ57_00110 Help Entry BOQ57_00110       CDS       T04629                                  Name (GenBank) ATP F0F1 synthase subunit C   KO K02110   F-type H+-transporting ATPase subunit c Organism aaj  Aeromonas hydrophila MX16A Pathway aaj00190   Oxidative phosphorylation aaj01100   Metabolic pathways Module aaj_M00157   F-type ATPase, prokaryotes and chloroplasts Brite KEGG Orthology (KO) [BR:aaj00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     BOQ57_00110  09180 Brite Hierarchies   09181 Protein families: metabolism    00194 Photosynthesis proteins [BR:aaj00194]     BOQ57_00110 Photosynthesis proteins [BR:aaj00194]  Photosystem and electron transport system   F-type ATPase [OT]    BOQ57_00110 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ATP-synt_C Motif Other DBs NCBI-ProteinID:  APJ13399 UniProt:  A0A081UXB8 LinkDB All DBs Position 22653..22895 Genome browser AA seq 80 aa AA seqDB search MENLNMDLLYIAAAMMMGLAAIGASIGIGILGGKFLEGAARQPDLIPVLRTQFFIVMGLV DAIPMIAVGLGLYVMFAVAG NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atggaaaacttgaacatggacctgctgtacatcgctgctgcaatgatgatgggtctggcg gctatcggcgcgtccatcggtatcggtatcctgggtggcaagttcctggaaggcgctgct cgtcaacctgacctgatccctgttctgcgtacccagttcttcatcgtgatgggtctggtg gatgcgatcccgatgatcgccgttggtctgggtctgtacgtgatgtttgcggttgctggc taa

DBGET integrated database retrieval system