Aeromonas hydrophila MX16A: BOQ57_00830 Help Entry BOQ57_00830       CDS       T04629                                  Name (GenBank) cell division protein ZapB   KO K09892   cell division protein ZapB Organism aaj  Aeromonas hydrophila MX16A Brite KEGG Orthology (KO) [BR:aaj00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:aaj03036]     BOQ57_00830 Chromosome and associated proteins [BR:aaj03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     BOQ57_00830 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ZapB YabA DUF2046 HR1 TSC22 BicD Nuf2_DHR10-like Uso1_p115_C ADIP CCDC138_cc NUDE_C K-box Mod_r Spectrin XRCC4 TolA_bind_tri GAS DivIC DUF6262 Herpes_UL6 FliT DUF2203 DUF244 DUF2968 CtIP_N Cep57_MT_bd FlaC_arch bZIP_1 Spc24 APG6_N AKNA bZIP_2 Spc7 Prominin DUF2205 Motif Other DBs NCBI-ProteinID:  APJ13528 UniProt:  A0A081UXQ2 LinkDB All DBs Position 169359..169568 Genome browser AA seq 69 aa AA seqDB search MSLEVLEQLESKVQSAVDNISLLKMELDELKEQNNKLQDENHQLRNEHVAWQERLRALLG KMDQMGESI NT seq 210 nt NT seq  +upstreamnt  +downstreamnt atgtcactagaagtccttgagcaactcgaatccaaagtacaatccgccgtcgacaacatc tccctgctgaagatggagctggacgagctgaaagagcagaacaacaagctgcaagacgag aaccatcagctgcgcaacgagcacgtcgcctggcaagagcgtctgcgtgccctgctgggc aagatggaccagatgggcgaaagcatctga

DBGET integrated database retrieval system