KEGG   Aeromonas hydrophila MX16A: BOQ57_03960
Entry
BOQ57_03960       CDS       T04629                                 
Name
(GenBank) ribonuclease III
  KO
K03685  ribonuclease III [EC:3.1.26.3]
Organism
aaj  Aeromonas hydrophila MX16A
Pathway
aaj03008  Ribosome biogenesis in eukaryotes
Brite
KEGG Orthology (KO) [BR:aaj00001]
 09120 Genetic Information Processing
  09122 Translation
   03008 Ribosome biogenesis in eukaryotes
    BOQ57_03960
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:aaj03019]
    BOQ57_03960
   03009 Ribosome biogenesis [BR:aaj03009]
    BOQ57_03960
   03036 Chromosome and associated proteins [BR:aaj03036]
    BOQ57_03960
Enzymes [BR:aaj01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.26  Endoribonucleases producing 5'-phosphomonoesters
    3.1.26.3  ribonuclease III
     BOQ57_03960
Messenger RNA biogenesis [BR:aaj03019]
 Prokaryotic type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Ribonucreases
     BOQ57_03960
Ribosome biogenesis [BR:aaj03009]
 Eukaryotic type
  90S particles
   RNase
    BOQ57_03960
 Prokaryotic type
  rRNA processing factors
   BOQ57_03960
Chromosome and associated proteins [BR:aaj03036]
 Eukaryotic type
  Gene silencing
   microRNA pathway
    Microprocessor complex
     BOQ57_03960
SSDB
Motif
Pfam: Ribonucleas_3_3 Ribonuclease_3 dsrm RM44_endonuclase DND1_DSRM DSRM_2
Other DBs
NCBI-ProteinID: APJ14105
UniProt: A0AAQ2RKM6
LinkDB
Position
823809..824480
AA seq 223 aa
MNIKMNRLQSRLGHVFQDQELLTRALTHRSAGSRHNERLEFLGDSILSLVIADDLFHRFP
QAAEGDLSRMRATLVREKTLAELGREFDLGDHLILGPGELKSGGFRRESILADTVEAVIG
AVYLDTNLETVRTLLLGWYASRLEEIKPGIEQKDPKTRLQEILQGSRKSLPTYTVTNVKG
EAHNQEFTVQCDVEGLDGPLVGVGTSRRKAEQAAAQQALEKLS
NT seq 672 nt   +upstreamnt  +downstreamnt
atgaatatcaagatgaacagactgcagtcccgtctagggcatgtctttcaggatcaagaa
ctgctgacccgggcgctgactcaccgcagcgccggttcccgtcacaacgagcgactggaa
ttcctgggtgactccattttgagtctggtgattgccgatgatctcttccaccgcttcccg
caggcggcggaaggggatctcagtcgcatgcgcgccaccctggtgcgcgagaagaccctg
gccgaactgggccgggagttcgacctcggggatcacctgatcctggggccgggtgagctg
aaaagcggcggttttcgccgtgaatccattctggccgacacggtcgaggcggtgatcggc
gccgtctatctggataccaatcttgagacggtacggacgctgctgctgggctggtacgcc
agccgcctggaggagatcaaaccgggcatagagcagaaggatcccaagacccgtctgcaa
gaaattctgcagggaagccgcaaatccctgccgacctacactgtgaccaacgtcaagggc
gaagcccacaaccaggagttcaccgtccagtgtgacgtggaaggcctggatggtccgctg
gtcggggtcggcaccagccgtcgcaaggccgaacaggccgctgcgcagcaagcattggaa
aaactgtcatga

DBGET integrated database retrieval system