Aeromonas hydrophila MX16A: BOQ57_04260 Help Entry BOQ57_04260       CDS       T04629                                  Symbol groES Name (GenBank) co-chaperone GroES   KO K04078   chaperonin GroES Organism aaj  Aeromonas hydrophila MX16A Brite KEGG Orthology (KO) [BR:aaj00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:aaj03110]     BOQ57_04260 (groES)    03029 Mitochondrial biogenesis [BR:aaj03029]     BOQ57_04260 (groES) Chaperones and folding catalysts [BR:aaj03110]  Heat shock proteins   HSP10    BOQ57_04260 (groES) Mitochondrial biogenesis [BR:aaj03029]  Mitochondrial protein import machinery   Matrix    Other matrix factors     BOQ57_04260 (groES) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Cpn10 DUF7205 Rad9_Rad53_bind Motif Other DBs NCBI-ProteinID:  APJ14162 UniProt:  A0A081UV28 LinkDB All DBs Position 889215..889508 Genome browser AA seq 97 aa AA seqDB search MKIRPLHDRVIIKRIEAEAKSAGGIVLTGTAAQKSTRGEVLAVGTGRILDNGDVKALAVK VGDKVIFNEGYGVKTEKLDGQDVLILSETDILAIVEE NT seq 294 nt NT seq  +upstreamnt  +downstreamnt atgaaaattcgtccactgcacgaccgcgtcatcatcaagcgcatcgaagctgaagccaaa tccgctggcggcattgtcttgactggtactgcggcccagaagtccacccgtggtgaagtt cttgccgtggggactggccgaattctggataatggcgatgtcaaagccctcgctgtcaag gttggtgacaaggtgatcttcaacgaaggctacggtgtgaagaccgagaagctggatggt caggacgtactgatcctgtctgaaaccgacatcctggcgattgtcgaagagtaa

DBGET integrated database retrieval system