Aeromonas hydrophila MX16A: BOQ57_09635 Help Entry BOQ57_09635       CDS       T04629                                  Name (GenBank) damage-inducible protein I   KO K12149   DNA-damage-inducible protein I Organism aaj  Aeromonas hydrophila MX16A Brite KEGG Orthology (KO) [BR:aaj00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03400 DNA repair and recombination proteins [BR:aaj03400]     BOQ57_09635 DNA repair and recombination proteins [BR:aaj03400]  Prokaryotic type   TLS (translesion DNA synthesis) factors    Other SOS response factors     BOQ57_09635 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DinI Motif Other DBs NCBI-ProteinID:  APJ15167 UniProt:  A0A0F6KC59 LinkDB All DBs Position 2038357..2038605 Genome browser AA seq 82 aa AA seqDB search MRLEIIIDKKHQVPTSTMEALRQELLKQLGEKFPDLHVRVAPGSAMALTVSRASKEDKEL AEAMVQEVWENADSWMPESVAS NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atgcgtctggaaatcatcatcgacaaaaaacatcaggtgcccacctcgaccatggaggcg ctgcgtcaggagctgctcaagcaactgggcgagaaattccccgacctgcatgtgcgggtc gcccccggcagtgccatggcactgactgtcagccgcgccagcaaggaggacaaggagctg gcagaagccatggtgcaggaggtgtgggagaatgccgacagctggatgccggagagtgtt gcctcctga

DBGET integrated database retrieval system