Aeromonas hydrophila MX16A: BOQ57_17380 Help Entry BOQ57_17380       CDS       T04629                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism aaj  Aeromonas hydrophila MX16A Pathway aaj01100   Metabolic pathways aaj01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:aaj00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     BOQ57_17380    00074 Mycolic acid biosynthesis     BOQ57_17380   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     BOQ57_17380 SSDB OrthologParalogGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  APJ16598 UniProt:  A0A081UME7 LinkDB All DBs Position complement(3799647..3799895) Genome browser AA seq 82 aa AA seqDB search MTRDDIFAQIKAALVELFEVDEEAITPEARLYQDLELDSIDAIDLVVHLQKLTGKKIKPE EFKSVRSVNDVVDAVERLLADA NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atgacccgtgacgacatctttgcccagatcaaggctgccctcgtcgagctgttcgaggtc gacgaagaggccatcacccccgaggcccgtctctatcaggatctcgagctcgacagcatc gacgccatcgatctggtggtgcacctgcagaagctgaccggcaagaagatcaagccggaa gagttcaagtcggtgcgcagcgtcaatgacgtggtggatgcggtcgagcgtctgctggcc gacgcctga

DBGET integrated database retrieval system