Aminobacter aminovorans: AA2016_4534 Help Entry AA2016_4534       CDS       T04343                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism aak  Aminobacter aminovorans Pathway aak01100   Metabolic pathways aak01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:aak00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     AA2016_4534   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     AA2016_4534 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L12_N TerB Motif Other DBs NCBI-ProteinID:  AMS43444 LinkDB All DBs Position complement(4622219..4622455) Genome browser AA seq 78 aa AA seqDB search MSDTAERVKKIVIEHLGVDADKVTEAASFIDDLGADSLDTVELVMAFEEEFGVEIPDDAA ETILTVGDAVKYIDKASA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagtgacaccgcagagcgcgtcaagaagatcgtcatcgaacatcttggcgtcgacgcc gacaaggtgacggaagctgcgagcttcatcgacgatctgggcgcggacagcctcgacacg gtcgagctcgtcatggctttcgaagaagaattcggcgtcgagatccccgatgatgcggcc gagaccatcctcaccgttggcgacgccgtgaagtacatcgacaaggcttcggcctga

DBGET integrated database retrieval system