Alteromonas australica H 17: EP13_17755 Help Entry EP13_17755        CDS       T03220                                  Name (GenBank) membrane protein   KO K00424   cytochrome bd-I ubiquinol oxidase subunit X [EC:7.1.1.7] Organism aal  Alteromonas australica H 17 Pathway aal00190   Oxidative phosphorylation aal01100   Metabolic pathways aal02020   Two-component system Module aal_M00153   Cytochrome bd ubiquinol oxidase Brite KEGG Orthology (KO) [BR:aal00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     EP13_17755  09130 Environmental Information Processing   09132 Signal transduction    02020 Two-component system     EP13_17755 Enzymes [BR:aal01000]  7. Translocases   7.1  Catalysing the translocation of protons    7.1.1  Linked to oxidoreductase reactions     7.1.1.7  quinol oxidase (electrogenic, proton-motive force generating)      EP13_17755 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  YbgT_YccB Motif Other DBs NCBI-ProteinID:  AIG00377 UniProt:  A0A075P3I1 LinkDB All DBs Position complement(3983656..3983769) Genome browser AA seq 37 aa AA seqDB search MWYFTWILGVLLACSFGIINAMWLESTENLDRPEDAE NT seq 114 nt NT seq  +upstreamnt  +downstreamnt atgtggtatttcacatggattttaggcgtattactcgcgtgttcttttggcattatcaac gccatgtggttggaatcgactgaaaacctagatcgccccgaagacgctgaataa

DBGET integrated database retrieval system