Aureimonas sp. OT7: IGS74_13675 Help Entry IGS74_13675       CDS       T06837                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism aala  Aureimonas sp. OT7 Pathway aala01100   Metabolic pathways aala01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:aala00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     IGS74_13675    00074 Mycolic acid biosynthesis     IGS74_13675   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     IGS74_13675 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L12_N ACP_SdgA_C DUF1493 Motif Other DBs NCBI-ProteinID:  QOG05640 LinkDB All DBs Position complement(2863596..2863832) Genome browser AA seq 78 aa AA seqDB search MSDTAERVKKIVVEHLGVEQEKVTENASFIDDLGADSLDTVELVMAFEEEFGVEIPDDAA ETILTVGDAVKFIEKNQG NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcgataccgctgaacgggtgaagaagatcgtcgtcgaacatcttggcgtcgaacag gagaaggtgaccgagaacgccagcttcatcgacgacctcggcgccgacagcctggacacg gtcgaactcgtcatggctttcgaggaagagttcggcgtcgagattccggacgatgccgcc gagacgatcctgacggtcggcgacgccgtgaagttcatcgaaaagaatcagggctga

DBGET integrated database retrieval system