Aedes albopictus (Asian tiger mosquito): 109399074 Help Entry 109399074         CDS       T06060                                  Name (RefSeq) defensin-A   KO K20668   defensin Organism aalb  Aedes albopictus (Asian tiger mosquito) Pathway aalb04624   Toll and Imd signaling pathway Brite KEGG Orthology (KO) [BR:aalb00001]  09150 Organismal Systems   09151 Immune system    04624 Toll and Imd signaling pathway     109399074  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:aalb02000]     109399074 Transporters [BR:aalb02000]  Other transporters   Pores ion channels [TC:1]    109399074 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Defensin_2 Gamma-thionin Defensin Motif Other DBs NCBI-GeneID:  109399074 NCBI-ProteinID:  XP_019527044 UniProt:  A0A023ECL8 LinkDB All DBs Position Unknown AA seq 98 aa AA seqDB search MQSLSVICFLAMCLVAITSAYPQEPVLADEARPVANSLFDELPEESYQAAVENLRLKRAT CDLLSGFGVGDSACAAHCIARGNRGGYCNSKKVCVCRN NT seq 297 nt NT seq  +upstreamnt  +downstreamnt atgcagtccctcagtgtgatttgtttcctggctatgtgcctcgtggccatcactagcgct tacccacaggaacctgtgctggcggacgaggcccgtcctgttgccaattctcttttcgat gaacttccggaggaatcctaccaggctgccgtggagaacttgcgcctcaagcgggccacc tgcgatctgctgagcggattcggcgtgggtgacagtgcttgtgctgcccattgcattgcc cggggcaatcggggaggttactgcaactccaagaaggtgtgcgtctgccggaactga

DBGET integrated database retrieval system