Aedes albopictus (Asian tiger mosquito): 109406147 Help Entry 109406147         CDS       T06060                                  Name (RefSeq) GTPase HRas   KO K07827   GTPase KRas Organism aalb  Aedes albopictus (Asian tiger mosquito) Pathway aalb04013   MAPK signaling pathway - fly aalb04068   FoxO signaling pathway aalb04137   Mitophagy - animal aalb04140   Autophagy - animal aalb04150   mTOR signaling pathway aalb04213   Longevity regulating pathway - multiple species aalb04214   Apoptosis - fly aalb04320   Dorso-ventral axis formation Brite KEGG Orthology (KO) [BR:aalb00001]  09130 Environmental Information Processing   09132 Signal transduction    04013 MAPK signaling pathway - fly     109406147    04068 FoxO signaling pathway     109406147    04150 mTOR signaling pathway     109406147  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     109406147    04137 Mitophagy - animal     109406147   09143 Cell growth and death    04214 Apoptosis - fly     109406147  09150 Organismal Systems   09158 Development and regeneration    04320 Dorso-ventral axis formation     109406147   09149 Aging    04213 Longevity regulating pathway - multiple species     109406147  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:aalb04131]     109406147   09183 Protein families: signaling and cellular processes    04031 GTP-binding proteins [BR:aalb04031]     109406147 Membrane trafficking [BR:aalb04131]  Endocytosis   Macropinocytosis    Ras GTPases     109406147 GTP-binding proteins [BR:aalb04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     109406147 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N Septin DUF2951 Motif Other DBs NCBI-GeneID:  109406147 NCBI-ProteinID:  XP_019534752 UniProt:  A0A023EJ57 LinkDB All DBs Position Unknown AA seq 190 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLLVFAVNSAKSFEDIGTYREQIKRVKDAEEVPMVLVGNKCDL QAWAVDMNQARDVAKQYGVPFVETSAKTRMGVDDAFYTLVREIRKDKERGKKNRKHNKLG SSRRFKCRLL NT seq 573 nt NT seq  +upstreamnt  +downstreamnt atgactgaatacaaactggtagtggtcggtgctggaggtgtcggcaagtcggcgctcacg atacaactcatccagaatcactttgtggacgaatatgaccccaccattgaagattcctac cggaaacaagtcgtgattgatggtgaaacgtgtttattagatattctagatacagcagga caagaagaatactccgctatgcgagatcaatacatgaggactggcgaaggttttttgcta gtttttgcagtgaacagtgccaaaagcttcgaagatataggaacctatcgagagcaaatc aagcgcgtcaaagatgcagaagaagttcccatggttctagtcggtaacaaatgtgatctg caggcgtgggccgtagacatgaaccaagccagagatgtggccaaacaatatggagtacca tttgttgaaacgtccgccaaaactcgaatgggagttgacgatgccttctacacactggtt cgtgagatccgcaaagacaaagaaagagggaagaaaaaccggaagcacaataaacttggc tccagtcggcggttcaaatgtcgactgctgtaa

DBGET integrated database retrieval system