Aedes albopictus (Asian tiger mosquito): 109409984 Help Entry 109409984         CDS       T06060                                  Name (RefSeq) ras-related protein Rac1   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism aalb  Aedes albopictus (Asian tiger mosquito) Pathway aalb04013   MAPK signaling pathway - fly aalb04145   Phagosome aalb04148   Efferocytosis aalb04310   Wnt signaling pathway aalb04517   IgSF CAM signaling aalb04518   Integrin signaling aalb04620   Toll-like receptor signaling pathway aalb05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:aalb00001]  09130 Environmental Information Processing   09132 Signal transduction    04013 MAPK signaling pathway - fly     109409984    04310 Wnt signaling pathway     109409984   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     109409984    04518 Integrin signaling     109409984  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     109409984    04148 Efferocytosis     109409984  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     109409984  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     109409984  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:aalb04131]     109409984   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:aalb04147]     109409984    04031 GTP-binding proteins [BR:aalb04031]     109409984 Membrane trafficking [BR:aalb04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     109409984  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     109409984   Macropinocytosis    Ras GTPases     109409984  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     109409984 Exosome [BR:aalb04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    109409984   Exosomal proteins of other body fluids (saliva and urine)    109409984   Exosomal proteins of colorectal cancer cells    109409984   Exosomal proteins of bladder cancer cells    109409984 GTP-binding proteins [BR:aalb04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     109409984 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Motif Other DBs NCBI-GeneID:  109409984 NCBI-ProteinID:  XP_029725830 LinkDB All DBs Position Unknown AA seq 193 aa AA seqDB search MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPINLGLWDTAG QEDYDRLRPLSYPQTDVFLICFSLVNPASFENVRAKWYPEVRHHCPNIPIILVGTKLDLR DDKQTVDKLRDKKLSPITYPQGLAMAKEIGAVKYLECSALTQKGLKTVFDEAIRAVLCPI IPVKNKLWRLFSY NT seq 582 nt NT seq  +upstreamnt  +downstreamnt atgcaggccatcaagtgcgtcgttgttggcgatggtgccgtgggtaagacctgtttgctg atcagctacacgaccaatgccttcccgggagagtacattccgaccgttttcgacaactat tctgcaaacgtcatggtcgatggaaagccaatcaacctgggactgtgggatacggccgga caggaagattacgatcgccttaggccgctgtcctacccgcagacggacgtgtttctcata tgcttctcgctggtcaatccggcctcgttcgagaacgtccgggccaagtggtatccggag gtgcgtcaccactgtccgaacataccgataatcctggtcggcaccaaactcgatctccgg gatgacaaacaaaccgtggataaactgcgcgacaagaagctgtccccgataacgtaccca cagggactggccatggccaaggagatcggcgccgtcaaatatctggaatgttctgccctg acccaaaagggcctcaaaaccgttttcgacgaagcgatccgagccgtcctctgtcccatc ataccggtgaaaaacaaactatggagactgttttcctactaa

DBGET integrated database retrieval system